DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32373 and Ltbp3

DIOPT Version :9

Sequence 1:NP_001261534.1 Gene:CG32373 / 318000 FlyBaseID:FBgn0052373 Length:486 Species:Drosophila melanogaster
Sequence 2:XP_006531731.1 Gene:Ltbp3 / 16998 MGIID:1101355 Length:1300 Species:Mus musculus


Alignment Length:514 Identity:124/514 - (24%)
Similarity:174/514 - (33%) Gaps:214/514 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 YSCRVN--YKLKRAKDNALYC-------------SNGIWL--GLKPNC-------IKIGKGNTHS 116
            |||..|  |   |:.....||             ..||.:  |...||       :.:|.|.   
Mouse   594 YSCHCNAGY---RSHPQHRYCVDVNECEAEPCGPGKGICMNTGGSYNCHCNRGYRLHVGAGG--- 652

  Fly   117 MKQKKMRCRIDNGGCA--HIC-------NRSTH-KCECYEGYTLNSTDLRSCNDIDECKE----- 166
                  |..:|...|.  |:|       |...| ||.||.||.|.::....|.|||||::     
Mouse   653 ------RSCVDLNECTKPHLCGDGGFCINFPGHYKCNCYPGYRLKASRPPICEDIDECRDPSTCP 711

  Fly   167 ---------------------SNGG--------CSQ-------VCNNLPGEFICTCNSGFEIDES 195
                                 |.||        ||:       .|.||||.:.|||..|:| ...
Mouse   712 DGKCENKPGSFKCIACQPGYRSQGGGACRDVNECSEGTPCSPGWCENLPGSYRCTCAQGYE-PAQ 775

  Fly   196 DEKTCLDIDECADPELSWDCTAG-CKNLNGTYKCLPSLVGRVEPTDGDGFSPGEIVCKSGFKLSD 259
            |..:|:|:|||   |....|..| |.|..|:::|                     .|.||:.||.
Mouse   776 DGLSCIDVDEC---EAGKVCQDGICTNTPGSFQC---------------------QCLSGYHLSR 816

  Fly   260 DGSECQDINECDL--ADIDSD------SWR---------MTYRYCEH---------------KCE 292
            |.|.|:||:|||.  |.|..|      |:|         :..|.|:.               .||
Mouse   817 DRSRCEDIDECDFPAACIGGDCINTNGSYRCLCPQGHRLVGGRKCQDIDECSQDPGLCLPHGACE 881

  Fly   293 NTVGSYICHCPQGYHLLDDQNSCILDGSKLPPSK-------------DAPVSQEAPRK------- 337
            |..|||:|.|.:|:.|..||:.|  :..:.|..|             |:.::....::       
Mouse   882 NLQGSYVCVCDEGFTLTQDQHGC--EEVEQPHHKKECYLNFDDTVFCDSVLATNVTQQECCCSLG 944

  Fly   338 ----DICPLFKGPANGKASCDKYLQNGFNYTRCNITCNAGY---------IMQGSQFAVCGHTGL 389
                |.|.::..|....|.......:|..||:.|...|.|.         |:.|::  :|     
Mouse   945 AGWGDHCEIYPCPVYSSAEFHSLCPDGKGYTQDNNIVNYGIPAHRDIDECILFGAE--IC----- 1002

  Fly   390 WSSPEAKCVESLALSCPVLTPP------RNGRFYPAS---------CNNEPSKSLAICE 433
               .|.|||.         |.|      :.|.:|..:         |.:|.:....:||
Mouse  1003 ---KEGKCVN---------TQPGYECYCKQGFYYDGNLLECVDVDECLDESNCRNGVCE 1049

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32373NP_001261534.1 FXa_inhibition 124..158 CDD:291342 13/43 (30%)
vWFA <158..199 CDD:294047 22/81 (27%)
FXa_inhibition 287..315 CDD:291342 13/42 (31%)
CCP 340..398 CDD:153056 14/66 (21%)
Ltbp3XP_006531731.1 EGF_CA 352..387 CDD:214542
TB 411..453 CDD:366245
EGF_CA 613..656 CDD:214542 8/51 (16%)
EGF_CA 657..691 CDD:238011 12/33 (36%)
EGF_CA 700..733 CDD:214542 5/32 (16%)
EGF_CA 741..781 CDD:214542 13/40 (33%)
EGF_CA 782..822 CDD:214542 18/63 (29%)
EGF_CA 823..862 CDD:214542 11/38 (29%)
EGF_CA 863..896 CDD:214542 9/32 (28%)
TB 926..969 CDD:366245 5/42 (12%)
EGF_CA 1033..>1061 CDD:214542 4/17 (24%)
EGF_CA 1079..1114 CDD:214542
TB 1144..>1179 CDD:366245
EGF_CA 1251..1289 CDD:214542
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.