DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32373 and CLEC14A

DIOPT Version :9

Sequence 1:NP_001261534.1 Gene:CG32373 / 318000 FlyBaseID:FBgn0052373 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_778230.1 Gene:CLEC14A / 161198 HGNCID:19832 Length:490 Species:Homo sapiens


Alignment Length:283 Identity:55/283 - (19%)
Similarity:89/283 - (31%) Gaps:127/283 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 SMKQKKMRCRIDNGGCAHICNRSTHKCECYEGYTLNSTDLRSCNDIDECKESNGGCSQVCNNLPG 180
            ::::::..|.::|              |...|::..|:|                        ||
Human    95 ALERRRSHCTLEN--------------EPLRGFSWLSSD------------------------PG 121

  Fly   181 EFICTCNSGFEIDESDEKTCLDIDECADPELSWDCTA-GCKNLNGTYKCLPSLVGRVEPTD---- 240
                    |.|.|     |...::|   |:.|  ||| .|..|..|        |.|||..    
Human   122 --------GLESD-----TLQWVEE---PQRS--CTARRCAVLQAT--------GGVEPAGWKEM 160

  Fly   241 -----GDGF---SPGEIVC-------------KSGFKL-------SDDGSE----CQ---DINEC 270
                 .:|:   ...|::|             ::.|:|       |..|:|    |:   .|:..
Human   161 RCHLRANGYLCKYQFEVLCPAPRPGAASNLSYRAPFQLHSAALDFSPPGTEVSALCRGQLPISVT 225

  Fly   271 DLADIDSDSWRMTY---------RY-----CEH--KCENTVGSYICHCPQGYHLLDDQNSCILDG 319
            .:||.....|....         ||     |..  .|.:.:|.:.|.|..|:.|..|..||:..|
Human   226 CIADEIGARWDKLSGDVLCPCPGRYLRAGKCAELPNCLDDLGGFACECATGFELGKDGRSCVTSG 290

  Fly   320 SKLP-------PSKDAPVSQEAP 335
            ...|       |::..|.:..:|
Human   291 EGQPTLGGTGVPTRRPPATATSP 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32373NP_001261534.1 FXa_inhibition 124..158 CDD:291342 6/33 (18%)
vWFA <158..199 CDD:294047 5/40 (13%)
FXa_inhibition 287..315 CDD:291342 8/29 (28%)
CCP 340..398 CDD:153056
CLEC14ANP_778230.1 CLECT_thrombomodulin_like 32..175 CDD:153070 26/143 (18%)
FXa_inhibition 254..286 CDD:291342 8/31 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 286..349 6/28 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 428..461
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.