Sequence 1: | NP_001261534.1 | Gene: | CG32373 / 318000 | FlyBaseID: | FBgn0052373 | Length: | 486 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_778230.1 | Gene: | CLEC14A / 161198 | HGNCID: | 19832 | Length: | 490 | Species: | Homo sapiens |
Alignment Length: | 283 | Identity: | 55/283 - (19%) |
---|---|---|---|
Similarity: | 89/283 - (31%) | Gaps: | 127/283 - (44%) |
- Green bases have known domain annotations that are detailed below.
Fly 116 SMKQKKMRCRIDNGGCAHICNRSTHKCECYEGYTLNSTDLRSCNDIDECKESNGGCSQVCNNLPG 180
Fly 181 EFICTCNSGFEIDESDEKTCLDIDECADPELSWDCTA-GCKNLNGTYKCLPSLVGRVEPTD---- 240
Fly 241 -----GDGF---SPGEIVC-------------KSGFKL-------SDDGSE----CQ---DINEC 270
Fly 271 DLADIDSDSWRMTY---------RY-----CEH--KCENTVGSYICHCPQGYHLLDDQNSCILDG 319
Fly 320 SKLP-------PSKDAPVSQEAP 335 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32373 | NP_001261534.1 | FXa_inhibition | 124..158 | CDD:291342 | 6/33 (18%) |
vWFA | <158..199 | CDD:294047 | 5/40 (13%) | ||
FXa_inhibition | 287..315 | CDD:291342 | 8/29 (28%) | ||
CCP | 340..398 | CDD:153056 | |||
CLEC14A | NP_778230.1 | CLECT_thrombomodulin_like | 32..175 | CDD:153070 | 26/143 (18%) |
FXa_inhibition | 254..286 | CDD:291342 | 8/31 (26%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 286..349 | 6/28 (21%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 428..461 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |