DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32373 and Fbn2

DIOPT Version :9

Sequence 1:NP_001261534.1 Gene:CG32373 / 318000 FlyBaseID:FBgn0052373 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_034311.2 Gene:Fbn2 / 14119 MGIID:95490 Length:2907 Species:Mus musculus


Alignment Length:399 Identity:115/399 - (28%)
Similarity:159/399 - (39%) Gaps:117/399 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 NALYCSNGIWLG--------------LKP---NCIKIGKGNTHSMKQKKMRCRIDNGGCAHICNR 137
            |.|.|..|..:.              |.|   :|:.|   |..|:...  .||  ||.|.::.  
Mouse  1158 NPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVDI---NECSLSDN--LCR--NGKCVNMI-- 1213

  Fly   138 STHKCECYEGYTLNSTDLRSCNDIDECKESNGGCSQVCNNLPGEFICTCNSGFEIDESDEKTCLD 202
            .|::|.|..||.. :.|.:.|.|||||...||||...|.|..|.:.|:|:.|:.: ..|.::|.|
Mouse  1214 GTYQCSCNPGYQA-TPDRQGCTDIDECMIMNGGCDTQCTNSEGSYECSCSEGYAL-MPDGRSCAD 1276

  Fly   203 IDECA-DPELSWDCTAG-CKNLNGTYKCLPSLVGRVEPTDGDGFSPGEIVCKSGFKLSDDGSECQ 265
            ||||. :|::   |..| |.|:.|.|:||                     |..||..|.|...|.
Mouse  1277 IDECENNPDI---CDGGQCTNIPGEYRCL---------------------CYDGFMASMDMKTCI 1317

  Fly   266 DINECDLADIDSDSWRMTYRYCEH-KCENTVGSYICHCPQGYHLLDDQNSCI-LDGSKLPPSKDA 328
            |:|||||          ....|.. :||||.||:||||..||.:......|. :|..::....  
Mouse  1318 DVNECDL----------NPNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHN-- 1370

  Fly   329 PVSQEAPRKDICPLFKG----PANGKASC-DKYLQNGF---------NYT-RCNITCNAGYI-MQ 377
                       |.:...    |.:.|.|| :.::.||.         |.| :|:|  ||..: ..
Mouse  1371 -----------CDMHASCLNVPGSFKCSCREGWVGNGIKCIDLDECANGTHQCSI--NAQCVNTP 1422

  Fly   378 GSQFAVC--GHT--GLWSSPEAKCVESLALSCPVLTPPRNGRFYPASCNNEPSKSLAICELLCDR 438
            ||....|  |.|  |...|...:|.|:..| |      .||:     |.|.|....  ||  |:.
Mouse  1423 GSYRCACSEGFTGDGFTCSDVDECAENTNL-C------ENGQ-----CLNVPGAYR--CE--CEM 1471

  Fly   439 GYLPRMDTQ 447
            |:.|..|::
Mouse  1472 GFTPASDSR 1480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32373NP_001261534.1 FXa_inhibition 124..158 CDD:291342 11/33 (33%)
vWFA <158..199 CDD:294047 17/40 (43%)
FXa_inhibition 287..315 CDD:291342 13/28 (46%)
CCP 340..398 CDD:153056 20/77 (26%)
Fbn2NP_034311.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..58
Interaction with MFAP4. /evidence=ECO:0000250|UniProtKB:P35556 149..359
TB 225..258 CDD:279073
EGF_CA 276..>306 CDD:214542
TB 375..412 CDD:279073
EGF_CA 528..558 CDD:214542
EGF_CA 568..609 CDD:214542
EGF_CA 610..642 CDD:238011
cEGF 631..654 CDD:289433
EGF_CA 651..691 CDD:214542
TB 708..744 CDD:279073
cEGF 783..806 CDD:289433
EGF_CA 803..838 CDD:238011
TB 900..>928 CDD:279073
TB 1005..1040 CDD:279073
EGF_CA 1108..1142 CDD:214542
EGF_CA 1151..1183 CDD:214542 4/24 (17%)
EGF_CA 1193..1225 CDD:214542 12/40 (30%)
cEGF 1216..1238 CDD:289433 8/22 (36%)
FXa_inhibition 1239..1274 CDD:291342 12/35 (34%)
Plasmod_Pvs28 1286..1439 CDD:283826 54/201 (27%)
EGF_3 1364..1399 CDD:289699 7/47 (15%)
EGF_3 1405..1440 CDD:289699 12/36 (33%)
EGF_CA 1484..1519 CDD:214542
EGF_CA 1525..1556 CDD:214542
TB 1586..1621 CDD:279073
EGF_CA 1643..1675 CDD:214542
cEGF 1665..1688 CDD:289433
Interaction with MFAP4. /evidence=ECO:0000250|UniProtKB:P35556 1728..2164
TB 1742..1779 CDD:279073
EGF_CA 1801..1833 CDD:214542
vWFA <1840..1881 CDD:294047
vWFA <1880..1922 CDD:294047
EGF_CA 1927..1961 CDD:214542
EGF_CA 1966..2008 CDD:214542
EGF_CA 2049..2089 CDD:214542
TB 2106..2143 CDD:279073
EGF_CA 2164..2205 CDD:214542
EGF_CA 2206..2245 CDD:214542
vWFA <2244..2283 CDD:294047
TB 2390..2425 CDD:279073
vWFA <2482..2522 CDD:294047
vWFA <2520..2556 CDD:294047
EGF_CA 2607..>2636 CDD:214542
Cadherin_repeat <2821..>2868 CDD:206637
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BA2W
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.