DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32373 and Fbn1

DIOPT Version :9

Sequence 1:NP_001261534.1 Gene:CG32373 / 318000 FlyBaseID:FBgn0052373 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_032019.2 Gene:Fbn1 / 14118 MGIID:95489 Length:2873 Species:Mus musculus


Alignment Length:464 Identity:125/464 - (26%)
Similarity:173/464 - (37%) Gaps:145/464 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 IKNAKASVKLRRNGEHVFLVTYYSCRVN--YK-----LKRAKD------NALYCSNGIWLG---- 101
            |...:.|..|...|:.|.....:.|:.:  |:     :|...|      :.|.|..||...    
Mouse  1073 IDECRISPDLCGRGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGGICHNTEGS 1137

  Fly   102 ----------LKPN---CIKIGKGNTHSMKQKKMRCRID-----NGGCAHICNRSTHKCECYEGY 148
                      |.||   ||.|.:            |.:.     :|.|.::..:  ::|.|..||
Mouse  1138 YRCECPPGHQLSPNISACIDINE------------CELSANLCPHGRCVNLIGK--YQCACNPGY 1188

  Fly   149 TLNSTDLRSCNDIDECKESNGGCSQVCNNLPGEFICTCNSGFEIDESDEKTCLDIDECAD-PELS 212
            . .:.|...|.|||||...||||...|.|..|.:.|:|..||.: ..|:::|.|||||.| |.: 
Mouse  1189 H-PTHDRLFCVDIDECSIMNGGCETFCTNSDGSYECSCQPGFAL-MPDQRSCTDIDECEDNPNI- 1250

  Fly   213 WDCTAG-CKNLNGTYKCLPSLVGRVEPTDGDGFSPGEIVCKSGFKLSDDGSECQDINECDLADID 276
              |..| |.|:.|.|:||                     |..||..|:|...|.|:|||||    
Mouse  1251 --CDGGQCTNIPGEYRCL---------------------CYDGFMASEDMKTCVDVNECDL---- 1288

  Fly   277 SDSWRMTYRYC-EHKCENTVGSYICHCPQGYH------LLDDQNSCILDGSKLPPSKDAPVSQEA 334
                  ....| ...||||.||:||||..||.      ...|.|.|.:.            :...
Mouse  1289 ------NPNICLSGTCENTKGSFICHCDMGYSGKKGKTGCTDINECEIG------------AHNC 1335

  Fly   335 PRKDICPLFKGPANGKASCDK-YLQNGFNYTRCNITCNAGYIM----------QGSQFAVC--GH 386
            .|..:|....|  :.|.||.. ::.:|...|..: .|:.|..|          .||...:|  |:
Mouse  1336 GRHAVCTNTAG--SFKCSCSPGWIGDGIKCTDLD-ECSNGTHMCSQHADCKNTMGSYRCLCKDGY 1397

  Fly   387 T--GLWSSPEAKCVESLALSCPVLTPPRNGRFYPASCNNEPSKSLAICELLCDRGYLPRMDTQLI 449
            |  |...:...:|.|:|.| |      .||:     |.|.|....  ||  ||.|::|..|.:..
Mouse  1398 TGDGFTCTDLDECSENLNL-C------GNGQ-----CLNAPGGYR--CE--CDMGFVPSADGKAC 1446

  Fly   450 -----CAAP 453
                 |:.|
Mouse  1447 EDIDECSLP 1455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32373NP_001261534.1 FXa_inhibition 124..158 CDD:291342 8/38 (21%)
vWFA <158..199 CDD:294047 18/40 (45%)
FXa_inhibition 287..315 CDD:291342 15/34 (44%)
CCP 340..398 CDD:153056 16/72 (22%)
Fbn1NP_032019.2 TB 1707..1751 CDD:366245
EGF_CA 1768..>1799 CDD:214542
EGF_CA 1810..1842 CDD:214542
EGF_CA 1932..1973 CDD:311536
EGF_CA 1975..2010 CDD:238011
EGF_CA 2015..2055 CDD:389777
TB 2072..2114 CDD:366245
EGF_CA 2129..2167 CDD:214542
EGF_CA 2168..2207 CDD:214542
TB 2358..2393 CDD:366245
vWFA <2444..2484 CDD:381780
cEGF 2467..2490 CDD:372248
EGF_CA 2487..>2518 CDD:389777
EGF_CA 2526..2568 CDD:214542
EGF_CA 2569..>2598 CDD:214542
EGF_CA 2609..2640 CDD:214542
Fibrillin_U_N 48..82 CDD:375622
TB 194..>228 CDD:366245
EGF_CA 246..>276 CDD:214542
EGF_CA 288..329 CDD:214542
TB 344..389 CDD:366245
EGF_CA 492..523 CDD:214542
EGF_CA 532..573 CDD:214542
EGF_CA 574..614 CDD:214542
EGF_CA 615..648 CDD:214542
TB 671..713 CDD:366245
EGF_CA 725..765 CDD:389777
EGF_CA 767..>798 CDD:214542
cEGF 789..812 CDD:372248
TB 863..>892 CDD:366245
TB 968..1011 CDD:366245
EGF_CA 1072..1106 CDD:214542 7/32 (22%)
EGF_CA 1115..1151 CDD:214542 6/35 (17%)
EGF_CA 1157..1192 CDD:238011 8/49 (16%)
FXa_inhibition 1203..1238 CDD:373209 13/35 (37%)
EGF_3 1328..1363 CDD:372403 8/48 (17%)
EGF_3 1369..1404 CDD:372403 9/34 (26%)
cEGF 1428..1451 CDD:372248 7/26 (27%)
EGF_CA 1448..1488 CDD:214542 2/8 (25%)
EGF_CA 1489..1520 CDD:214542
TB 1551..1592 CDD:366245
EGF_CA 1608..1640 CDD:214542
EGF_CA 1650..1689 CDD:214542
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BA2W
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.