DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32373 and si:dkey-163f14.6

DIOPT Version :9

Sequence 1:NP_001261534.1 Gene:CG32373 / 318000 FlyBaseID:FBgn0052373 Length:486 Species:Drosophila melanogaster
Sequence 2:XP_009304399.1 Gene:si:dkey-163f14.6 / 100332398 ZFINID:ZDB-GENE-141215-18 Length:740 Species:Danio rerio


Alignment Length:279 Identity:86/279 - (30%)
Similarity:119/279 - (42%) Gaps:65/279 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 YSCRVNYKLKRAKDNALYCS-NGIWLGLKPNCIKIGKGNTHSMKQKKMRCRIDNGGCAHICNRST 139
            |:|...|.| .:.|...||. :|.|.|..|.|:::            ..|.:.||||:.||..:.
Zfish   491 YACYPGYTL-TSGDVYSYCEHDGQWSGQTPLCLEL------------TPCSLHNGGCSQICRVNE 542

  Fly   140 H---KCECYEGYTLNSTDLRSCNDIDECKESNGGCSQVCNNLPGEFICTCNSGFEIDESDEKTCL 201
            |   :|.|..|:.| ..|.|:|.|:|||.|....|.|.|.|..|.:.|:|:.||:: .:|..:|.
Zfish   543 HHRAQCVCKPGFLL-LEDQRTCRDLDECVEELHLCQQACENTLGSYRCSCSPGFQL-SADGTSCS 605

  Fly   202 DIDEC--ADPELSWDCTAGCKNLNGTYKCLPSLVGRVEPTDGDGFSPGEIVCKSGFKLSDDGSEC 264
            |:|||  ....|   |..||.|..|:::||                     |..|.:|......|
Zfish   606 DVDECQLVGRAL---CEFGCINTPGSFQCL---------------------CAEGHQLDSTNRHC 646

  Fly   265 QDINECDLADIDSDSWRMTYRYCEHKCENTVGSYICHCPQGY------HLLDDQNSCIL-DGSKL 322
            .|||||:...:         ..||.||.|..|:|.|.||:||      |..:|.|.|.| :||  
Zfish   647 IDINECEEEQL---------HMCEWKCVNLPGTYKCICPRGYRLHSNRHQCEDINECELKNGS-- 700

  Fly   323 PPSKDAPVSQEAPRKDICP 341
              .....::.....|..||
Zfish   701 --CSHLCINHRGDYKCACP 717

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32373NP_001261534.1 FXa_inhibition 124..158 CDD:291342 14/36 (39%)
vWFA <158..199 CDD:294047 16/40 (40%)
FXa_inhibition 287..315 CDD:291342 15/33 (45%)
CCP 340..398 CDD:153056 2/2 (100%)
si:dkey-163f14.6XP_009304399.1 CCP 28..79 CDD:153056
CCP 83..133 CDD:214478
CCP 461..521 CDD:214478 11/30 (37%)
FXa_inhibition 527..563 CDD:291342 14/36 (39%)
EGF_CA 565..604 CDD:284955 15/39 (38%)
EGF_CA 606..647 CDD:214542 15/64 (23%)
EGF_CA 648..689 CDD:214542 18/49 (37%)
FXa_inhibition 694..730 CDD:291342 7/28 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I12071
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R17329
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.