DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32373 and fbln7

DIOPT Version :9

Sequence 1:NP_001261534.1 Gene:CG32373 / 318000 FlyBaseID:FBgn0052373 Length:486 Species:Drosophila melanogaster
Sequence 2:XP_001918972.3 Gene:fbln7 / 100000083 -ID:- Length:442 Species:Danio rerio


Alignment Length:338 Identity:74/338 - (21%)
Similarity:115/338 - (34%) Gaps:124/338 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PAIDNNLSFQYDDTCWTPPRIKNAKASVKLRRNGEHVFL--VTYYSCRVNYKLKRAKDNALYC-S 95
            |..|.:||   ..:|  ||.:..|..    |:.|....|  ..:::|...::|.......  | .
Zfish    72 PQADQSLS---QSSC--PPLVAPANG----RKFGSKYLLGHEVHFTCSQGFRLVGPVTRV--CQE 125

  Fly    96 NGIWLGLKPNCIKIGKGNTHSMKQKKMRCRIDNGG-CAHICNRSTHKCECYEGYTLNSTDLRSCN 159
            ||.|.|...:|..:...:::.       |:  ||| |....|:  :||.|...:           
Zfish   126 NGTWSGATASCKDVSMCSSNP-------CQ--NGGTCVEALNK--YKCTCPYNW----------- 168

  Fly   160 DIDECKESNGGCSQVCNNLPGEFI---------------------CTCNSGFEID-ESDEKTCLD 202
                   |...|.......|.|:.                     |:|::||.:. .||...|.|
Zfish   169 -------SGSQCQYQTQTAPPEWSVMNDPAFSRKPRCAKVDRAQHCSCDAGFHMSGTSDNSICQD 226

  Fly   203 IDEC----AD---PELSWDCTAGCKNLNGTYKCLPSLVGRVEPTDGDGFSPGEIVCKSGFKLSDD 260
            ::||    ||   |.    |...|.|:.|:|.|                     .|.:|:||..|
Zfish   227 VNECEVYKADRGGPL----CVHACVNVPGSYHC---------------------SCPTGYKLLAD 266

  Fly   261 GSECQDINECDLADIDSDSWRMTYRY-CEH--KCENTVGSYIC---HCPQGY---------HLLD 310
            |..|:|::||           :|.:: |..  .|.||.|.:.|   .||..:         .|..
Zfish   267 GRSCEDVDEC-----------LTQQHNCSRGSTCINTGGGFQCVSPECPPAHANASYVKTSPLQC 320

  Fly   311 DQNSCILDGSKLP 323
            ::|.|.::....|
Zfish   321 ERNPCPMESRSCP 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32373NP_001261534.1 FXa_inhibition 124..158 CDD:291342 9/34 (26%)
vWFA <158..199 CDD:294047 10/62 (16%)
FXa_inhibition 287..315 CDD:291342 10/41 (24%)
CCP 340..398 CDD:153056
fbln7XP_001918972.3 CCP 83..137 CDD:153056 14/61 (23%)
EGF 142..172 CDD:278437 10/58 (17%)
vWFA <221..269 CDD:294047 19/72 (26%)
cEGF 252..275 CDD:289433 10/43 (23%)
EGF_CA 272..>302 CDD:284955 10/40 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002570
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.