DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32371 and mapre3a

DIOPT Version :9

Sequence 1:NP_729295.1 Gene:CG32371 / 317999 FlyBaseID:FBgn0052371 Length:294 Species:Drosophila melanogaster
Sequence 2:XP_005158903.1 Gene:mapre3a / 559217 ZFINID:ZDB-GENE-050913-88 Length:273 Species:Danio rerio


Alignment Length:291 Identity:114/291 - (39%)
Similarity:161/291 - (55%) Gaps:51/291 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VNVRYTNKLSSNSSRAEMLSWVNNTLKSQFFKVEELCTGAAYCQLMDILFARSIPMQRVKFRTNV 74
            |||..|:....|.||.:||:|||::|:..:.|:|:||:||||||.|::||...|.:::|||:..:
Zfish     3 VNVYSTSVTIENLSRHDMLAWVNDSLQLTYTKIEQLCSGAAYCQFMEMLFPGCILLKKVKFQAKL 67

  Fly    75 EYEYIQNFKLLQGCFNKFVVDKIIPIDRLVKGRYQDNFEFLQWFRKFFDANYESREYDPVIARNG 139
            |:|:|.|||:||..|.:..||||||::|||||::||||||:|||:|||||||:.:||||:.||.|
Zfish    68 EHEFIHNFKVLQAAFKRMNVDKIIPVERLVKGKFQDNFEFVQWFKKFFDANYDGKEYDPIQARQG 132

  Fly   140 AMLGLGSPPMEAK----LRKSVNKSNPQ-TKPTEESSAQTDR--ATTEPKNQVYKSNSENKTIEE 197
            .  .:..||...:    ..|....|.|| |.||...:..|.:  .||..||..:..|        
Zfish   133 Q--DVAPPPNPGEHFSHKPKRTGPSGPQRTSPTVPKNMPTPQRVTTTIRKNPTHARN-------- 187

  Fly   198 ASAQTDLAITEPENQVHESQTKTTEKASAQTEKATTEPDSEGSIEELRNYCKYVSRMKQERNFYL 262
              ..:|..|||...|:.|  .|.|                             |..:::||:||.
Zfish   188 --GGSDAEITELNQQLME--LKLT-----------------------------VDGLEKERDFYF 219

  Fly   263 SKLRAIDHICQKYNSGRDRVILEKITKIIYS 293
            ||||.|:.|||.:.:....|| .:|..|:|:
Zfish   220 SKLRDIELICQDHEAESSPVI-SRIIDILYA 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32371NP_729295.1 CH 22..121 CDD:278723 54/98 (55%)
BIM1 23..>269 CDD:227542 100/252 (40%)
EB1 255..293 CDD:281288 16/37 (43%)
mapre3aXP_005158903.1 CH 16..114 CDD:278723 54/97 (56%)
EB1 212..249 CDD:281288 16/37 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594755
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5217
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1237523at2759
OrthoFinder 1 1.000 - - FOG0000490
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100898
Panther 1 1.100 - - O PTHR10623
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X303
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.710

Return to query results.
Submit another query.