DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32371 and mapre1a

DIOPT Version :9

Sequence 1:NP_729295.1 Gene:CG32371 / 317999 FlyBaseID:FBgn0052371 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_956158.2 Gene:mapre1a / 334135 ZFINID:ZDB-GENE-030131-6067 Length:272 Species:Danio rerio


Alignment Length:293 Identity:117/293 - (39%)
Similarity:166/293 - (56%) Gaps:50/293 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VNVRYTNKLSSNSSRAEMLSWVNNTLKSQFFKVEELCTGAAYCQLMDILFARSIPMQRVKFRTNV 74
            |||..|:..|.|.||.:||:|:|.:|:....|:|:||||||||..||:||...:|:::|||:..:
Zfish     3 VNVFSTSVTSENLSRHDMLTWINESLQMNHAKIEQLCTGAAYCHFMDMLFPSCLPLKKVKFQAKL 67

  Fly    75 EYEYIQNFKLLQGCFNKFVVDKIIPIDRLVKGRYQDNFEFLQWFRKFFDANYESREYDPVIARNG 139
            |:|||.||||||..|.|..|.||||:|:||||::||||||:|||:|||||||:.:|||||.||.|
Zfish    68 EHEYIHNFKLLQASFKKMGVSKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKEYDPVAARQG 132

  Fly   140 AMLGLGSPPMEAKLRKSVNKSNPQTKPTEESSAQTDRATTEPKNQVYKSNSENKTIEEASAQTDL 204
                                   |..||.:|.|....|     |:..|.:|            |.
Zfish   133 -----------------------QDIPTNQSPAAAATA-----NKARKPSS------------DT 157

  Fly   205 AIT---EPENQVHESQTKTTEKASAQTEKATTE-----PDSEGSIEELRNYCK-YVSRMKQERNF 260
            .||   :|...|...::....|::|:|..|.|.     .:.:|::.::.|..| .::.|::||:|
Zfish   158 GITPAVKPMAPVAPQRSAAAPKSTAKTSPAATRGTGSGDEEKGALTQMINDLKATIADMEKERDF 222

  Fly   261 YLSKLRAIDHICQKYNSGRDRVILEKITKIIYS 293
            |..|||.|:.|||: ..|.....|:||..|:|:
Zfish   223 YFGKLRNIELICQE-KEGEGDPTLQKIVDILYA 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32371NP_729295.1 CH 22..121 CDD:278723 56/98 (57%)
BIM1 23..>269 CDD:227542 101/254 (40%)
EB1 255..293 CDD:281288 16/37 (43%)
mapre1aNP_956158.2 CH 16..114 CDD:278723 56/97 (58%)
EB1 217..254 CDD:281288 16/37 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594753
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5217
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1237523at2759
OrthoFinder 1 1.000 - - FOG0000490
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100898
Panther 1 1.100 - - O PTHR10623
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X303
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.710

Return to query results.
Submit another query.