DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32371 and MAPRE3

DIOPT Version :9

Sequence 1:NP_729295.1 Gene:CG32371 / 317999 FlyBaseID:FBgn0052371 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001289979.1 Gene:MAPRE3 / 22924 HGNCID:6892 Length:281 Species:Homo sapiens


Alignment Length:291 Identity:112/291 - (38%)
Similarity:164/291 - (56%) Gaps:43/291 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VNVRYTNKLSSNSSRAEMLSWVNNTLKSQFFKVEELCTGAAYCQLMDILFARSIPMQRVKFRTNV 74
            |||..|:..|.|.||.:||:|||::|...:.|:|:||:||||||.||:||...:.:::|||:..:
Human     3 VNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKL 67

  Fly    75 EYEYIQNFKLLQGCFNKFVVDKIIPIDRLVKGRYQDNFEFLQWFRKFFDANYESREYDPVIARNG 139
            |:|||.|||:||..|.|..||||||:::||||::||||||:|||:|||||||:.::|:|::||.|
Human    68 EHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKDYNPLLARQG 132

  Fly   140 AMLGLGSPPMEA-----KLRKSVNKSNPQ-TKPTEESSAQTD-RATTEPKNQVYKSNSENKTIEE 197
            .  .:..||...     |.:|.:..:.|| |.||...:.||. |.:......:.:.|.  .:...
Human   133 Q--DVAPPPNPGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNP--PSARN 193

  Fly   198 ASAQTDLAITEPENQVHESQTKTTEKASAQTEKATTEPDSEGSIEELRNYCKYVSRMKQERNFYL 262
            ...:||..|.|...|:.:  .|.|                             |..:::||:||.
Human   194 GGHETDAQILELNQQLVD--LKLT-----------------------------VDGLEKERDFYF 227

  Fly   263 SKLRAIDHICQKYNSGRDRVILEKITKIIYS 293
            ||||.|:.|||::.|....|| ..|..|:|:
Human   228 SKLRDIELICQEHESENSPVI-SGIIGILYA 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32371NP_729295.1 CH 22..121 CDD:278723 55/98 (56%)
BIM1 23..>269 CDD:227542 96/252 (38%)
EB1 255..293 CDD:281288 17/37 (46%)
MAPRE3NP_001289979.1 BIM1 16..279 CDD:227542 106/278 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 157..181 8/23 (35%)
DCTN1-binding 217..281 18/42 (43%)
APC-binding 217..260 18/42 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 261..281
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158811
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5217
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1237523at2759
OrthoFinder 1 1.000 - - FOG0000490
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100898
Panther 1 1.100 - - O PTHR10623
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X303
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.710

Return to query results.
Submit another query.