DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32371 and ebp-3

DIOPT Version :9

Sequence 1:NP_729295.1 Gene:CG32371 / 317999 FlyBaseID:FBgn0052371 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_507528.1 Gene:ebp-3 / 180181 WormBaseID:WBGene00007062 Length:187 Species:Caenorhabditis elegans


Alignment Length:192 Identity:46/192 - (23%)
Similarity:70/192 - (36%) Gaps:64/192 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 ARNGAMLGL---GSP--------------------PMEAKLRKSVNKSNPQTKPTEESSAQTDRA 177
            ||||.  ||   |.|                    |:......:...:.|.|:||...|:...||
 Worm     3 ARNGE--GLPTEGGPAAGASAKTPSRMPARSVPQKPVTTMRTPAATPAAPPTRPTPSRSSAAPRA 65

  Fly   178 T------TEPKNQVYKSNSENKTIEEASAQ---TDLAITEPENQVHESQTKTTEKASAQTEKAT- 232
            |      ..||.......|.:.....|:|.   .|:|              |..|...:.|:.| 
 Worm    66 TAPTPTAAPPKTCAPPVRSASTVAAAAAAAPPGVDMA--------------TFNKLKEELEEVTR 116

  Fly   233 --TEPDSEGSIEELRNYCKYVSRMKQERNFYLSKLRAIDHICQKYNSGRDRVILEKITKIIY 292
              ||.|:            .::.:::||:||.||||.|:.|||. |.....|.:.::.:::|
 Worm   117 QLTESDN------------VIASLEKERDFYFSKLRTIEVICQD-NESIGNVEVNRVLEVLY 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32371NP_729295.1 CH 22..121 CDD:278723
BIM1 23..>269 CDD:227542 39/167 (23%)
EB1 255..293 CDD:281288 15/38 (39%)
ebp-3NP_507528.1 EB1 128..166 CDD:367431 15/39 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166332
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5217
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1295
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1237523at2759
OrthoFinder 1 1.000 - - FOG0000490
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100898
Panther 1 1.100 - - O PTHR10623
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X303
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.660

Return to query results.
Submit another query.