DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32371 and ebp-2

DIOPT Version :9

Sequence 1:NP_729295.1 Gene:CG32371 / 317999 FlyBaseID:FBgn0052371 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_496438.1 Gene:ebp-2 / 174744 WormBaseID:WBGene00012156 Length:299 Species:Caenorhabditis elegans


Alignment Length:285 Identity:93/285 - (32%)
Similarity:138/285 - (48%) Gaps:51/285 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VVNVRYTNKLSSNSSRAEMLSWVNNTLKSQFFKVEELCTGAAYCQLMDILFARSIPMQRVKFRTN 73
            ||||..:...:...||.|.::||||.|||.|.||||:.:|||||||..:|| .:|.:::|||...
 Worm     2 VVNVFISAVTTDTLSRKEAVAWVNNLLKSHFTKVEEMASGAAYCQLTHLLF-NAINLKKVKFNPR 65

  Fly    74 VEYEYIQNFKLLQGCFNKFVVDKIIPIDRLVKGRYQDNFEFLQWFRKFFDANY--ESREYDPVIA 136
            .|.:.:.|:|:|...:....:||.:.::::.|.::|||.||||||.||::||.  |..|||.|.|
 Worm    66 SEPDVLNNWKVLTTTWKDLGIDKPVDVEKMKKAKFQDNMEFLQWFYKFYNANLTTEPEEYDAVGA 130

  Fly   137 RNG----AMLG-LGSPPMEAKLR------------------KSVNKSNPQ-----TKPTEESSAQ 173
            |.|    |:.| .||.|:.|..|                  .:|..|.|.     |:|...:||.
 Worm   131 RFGEDLPALKGSTGSRPVAAPARPVAAAPPKPRPAAPAVAAPAVKASVPPTVRNGTRPAPATSAG 195

  Fly   174 TDRATTEPKNQVYKSNSENKTIEEASAQTDLAITEPE-----------------NQVHESQTKTT 221
            |.||......::.|...|..  :.||.:.:....|.|                 |:..||.:.|.
 Worm   196 TRRADPSASEELLKQEIEKH--KAASDEWETTAKEMETEREYYYSILQRVESLANEAEESGSSTV 258

  Fly   222 EKASAQTEKATTEPDSEGSIEELRN 246
            :.|:.:|.......|:| .::|:.|
 Worm   259 DVAALKTILYAGNEDTE-QVDEIEN 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32371NP_729295.1 CH 22..121 CDD:278723 44/98 (45%)
BIM1 23..>269 CDD:227542 89/271 (33%)
EB1 255..293 CDD:281288
ebp-2NP_496438.1 CH 16..113 CDD:278723 44/97 (45%)
EB1 230..269 CDD:281288 7/38 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166333
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5217
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1295
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1237523at2759
OrthoFinder 1 1.000 - - FOG0000490
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100898
Panther 1 1.100 - - O PTHR10623
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X303
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.700

Return to query results.
Submit another query.