DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32371 and Mapre1

DIOPT Version :9

Sequence 1:NP_729295.1 Gene:CG32371 / 317999 FlyBaseID:FBgn0052371 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_612518.2 Gene:Mapre1 / 114764 RGDID:621781 Length:268 Species:Rattus norvegicus


Alignment Length:293 Identity:118/293 - (40%)
Similarity:164/293 - (55%) Gaps:56/293 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VNVRYTNKLSSNSSRAEMLSWVNNTLKSQFFKVEELCTGAAYCQLMDILFARSIPMQRVKFRTNV 74
            |||..|:..|.|.||.:||:|:|.:|:....|:|:||:||||||.||:||..||.:::|||:..:
  Rat     3 VNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKL 67

  Fly    75 EYEYIQNFKLLQGCFNKFVVDKIIPIDRLVKGRYQDNFEFLQWFRKFFDANYESREYDPVIARNG 139
            |:|||||||:||..|.:..||||||:|:||||::||||||:|||:|||||||:.:|||||.||.|
  Rat    68 EHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKEYDPVAARQG 132

  Fly   140 AMLGLGSPPMEAKLRKSVNKSNPQTKPTEESSA------QTDRATTEPK---NQVYKSNSENKTI 195
            ....: :|.:.|..     .|.|: ||....||      .|.|.|..||   ..|.|:.......
  Rat   133 QETAV-APSLVAPA-----LSKPK-KPLGSGSAAPQRPIATQRTTAAPKAGPGMVRKNPGMGNGD 190

  Fly   196 EEASAQTDLAITEPENQVHESQTKTTEKASAQTEKATTEPDSEGSIEELRNYCKYVSRMKQERNF 260
            :||:        |...||             :..|.|.|.                  :::||:|
  Rat   191 DEAA--------ELMQQV-------------KVLKLTVED------------------LEKERDF 216

  Fly   261 YLSKLRAIDHICQKYNSGRDRVILEKITKIIYS 293
            |..|||.|:.|||: |.|.:..:|::|..|:|:
  Rat   217 YFGKLRNIELICQE-NEGENDPVLQRIVDILYA 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32371NP_729295.1 CH 22..121 CDD:278723 57/98 (58%)
BIM1 23..>269 CDD:227542 102/254 (40%)
EB1 255..293 CDD:281288 16/37 (43%)
Mapre1NP_612518.2 BIM1 16..257 CDD:227542 112/280 (40%)
Interaction with MTUS2/TIP150. /evidence=ECO:0000250 124..268 47/172 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..191 13/45 (29%)
DCTN1-binding. /evidence=ECO:0000250 208..268 18/60 (30%)
APC-binding. /evidence=ECO:0000250 220..242 10/22 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352807
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5217
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1237523at2759
OrthoFinder 1 1.000 - - FOG0000490
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100898
Panther 1 1.100 - - O PTHR10623
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X303
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.710

Return to query results.
Submit another query.