DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32371 and mapre2

DIOPT Version :9

Sequence 1:NP_729295.1 Gene:CG32371 / 317999 FlyBaseID:FBgn0052371 Length:294 Species:Drosophila melanogaster
Sequence 2:NP_001120403.1 Gene:mapre2 / 100145479 XenbaseID:XB-GENE-6455519 Length:326 Species:Xenopus tropicalis


Alignment Length:296 Identity:104/296 - (35%)
Similarity:157/296 - (53%) Gaps:55/296 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VNVRYTNKLSSNSSRAEMLSWVNNTLKSQFFKVEELCTGAAYCQLMDILFARSIPMQRVKFRTNV 74
            |||..|:......||.::::|||:.:...:.|||:||:||||||.||:||...|.:::|||:..:
 Frog    45 VNVYSTSITQETMSRHDIIAWVNDIVCLNYIKVEQLCSGAAYCQFMDMLFPGCISLKKVKFQAKL 109

  Fly    75 EYEYIQNFKLLQGCFNKFVVDKIIPIDRLVKGRYQDNFEFLQWFRKFFDANYESREYDPVIARNG 139
            |:|||.||||||..|.:..|||:||:::|||||:|||.:|:|||:|||||||:.:||||:.||.|
 Frog   110 EHEYIHNFKLLQASFKRMNVDKVIPVEKLVKGRFQDNLDFIQWFKKFFDANYDGKEYDPMEARQG 174

  Fly   140 -----------AMLGLGSPPMEAKL-RKSVNKSNPQTKPTEESSAQTDRATTEPKNQVYKSNSEN 192
                       .:..|...|..|.. .....||:|..||...||..:......|...| ||:.:.
 Frog   175 QDALPPPDPGEQIFNLPKKPHHANSPTAGAAKSSPIAKPGSTSSRPSSAKKAAPTPSV-KSDKDL 238

  Fly   193 KTIEEASAQTDLAITEPENQVHESQTKTTEKASAQTEKATTEPDSEGSIEELRNYCKYVSRMKQE 257
            :|          .:::...|||..:...                 ||              :::|
 Frog   239 ET----------QVSQLNEQVHSLKIAL-----------------EG--------------VEKE 262

  Fly   258 RNFYLSKLRAIDHICQKYNSGRDRVILEKITKIIYS 293
            |:||..|||.|:.:||::....|.:: :::..|:||
 Frog   263 RDFYFGKLREIELLCQEHGQEGDDLV-QRLMDILYS 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32371NP_729295.1 CH 22..121 CDD:278723 52/98 (53%)
BIM1 23..>269 CDD:227542 93/257 (36%)
EB1 255..293 CDD:281288 12/37 (32%)
mapre2NP_001120403.1 BIM1 58..314 CDD:227542 100/283 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1237523at2759
OrthoFinder 1 1.000 - - FOG0000490
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X303
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.