DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tut and SART3

DIOPT Version :9

Sequence 1:NP_729346.1 Gene:tut / 317996 FlyBaseID:FBgn0052364 Length:230 Species:Drosophila melanogaster
Sequence 2:XP_005269298.1 Gene:SART3 / 9733 HGNCID:16860 Length:981 Species:Homo sapiens


Alignment Length:53 Identity:17/53 - (32%)
Similarity:29/53 - (54%) Gaps:2/53 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KGELFLSCIPRNHSCSPRWIVEVASELGEVYIMRYKIDFSGNSRGYAYLQYIN 88
            |.:||:|.:|  .||:...:.|:....|.|..:|...:.:|..:|.||::|.|
Human   818 KHKLFISGLP--FSCTKEELEEICKAHGTVKDLRLVTNRAGKPKGLAYVEYEN 868

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutNP_729346.1 RRM1_hnRNPR_like 36..115 CDD:240695 17/53 (32%)
DUF3388 <127..169 CDD:288701
SART3XP_005269298.1 RNA14 100..>478 CDD:227438
NRDE-2 351..>504 CDD:285605
RRM 654..876 CDD:223796 17/53 (32%)
RRM1_SART3 723..796 CDD:240837
RRM2_SART3 817..897 CDD:240838 17/53 (32%)
LSM_int_assoc 895..951 CDD:293211
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.