DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tut and PABPC4

DIOPT Version :9

Sequence 1:NP_729346.1 Gene:tut / 317996 FlyBaseID:FBgn0052364 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001129125.1 Gene:PABPC4 / 8761 HGNCID:8557 Length:660 Species:Homo sapiens


Alignment Length:223 Identity:40/223 - (17%)
Similarity:80/223 - (35%) Gaps:64/223 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QVNGTITITTRKVLDENLKSLLDE-----GKGELFLSCIPRN--HSCSPRWIVEVASELGEVYIM 68
            ::||.: :..|||.....||..:.     .|.:.|.:...:|  .......:.|:.|:.|:...:
Human   157 KMNGML-LNDRKVFVGRFKSRKEREAELGAKAKEFTNVYIKNFGEEVDDESLKELFSQFGKTLSV 220

  Fly    69 RYKIDFSGNSRGYAYLQYINVDLKESAMQYLPMRFRQLCMCLRVEPSTNNREL------------ 121
            :...|.:|.|:|:.::.|...:....|::.:                 |.:|:            
Human   221 KVMRDPNGKSKGFGFVSYEKHEDANKAVEEM-----------------NGKEISGKIIFVGRAQK 268

  Fly   122 -VLKNVESSLRPWQVYQEMLKIHPFTIVRVYEYQLDQFFYIFEYRNNDSAASAHQRVRNSIRKFG 185
             |.:..|...:..|:.||  :|..:..|.:|...||...       :|      :::|.....||
Human   269 KVERQAELKRKFEQLKQE--RISRYQGVNLYIKNLDDTI-------DD------EKLRKEFSPFG 318

  Fly   186 EHAHISWLTAENIL-----SRASGSFCF 208
            .      :|:..::     |:..|..||
Human   319 S------ITSAKVMLEDGRSKGFGFVCF 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutNP_729346.1 RRM1_hnRNPR_like 36..115 CDD:240695 12/80 (15%)
DUF3388 <127..169 CDD:288701 9/41 (22%)
PABPC4NP_001129125.1 PABP-1234 11..640 CDD:130689 40/223 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.