DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tut and PABN1

DIOPT Version :9

Sequence 1:NP_729346.1 Gene:tut / 317996 FlyBaseID:FBgn0052364 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001190511.1 Gene:PABN1 / 835186 AraportID:AT5G51120 Length:265 Species:Arabidopsis thaliana


Alignment Length:96 Identity:15/96 - (15%)
Similarity:45/96 - (46%) Gaps:14/96 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFESKYCTSQVNGTITITTRKVLDENLKSLLDEGKGELFLSCIPRNHSCSPRWIVEVASELGEV 65
            ::||  |....:|..::...::.:|..          .:::..:  :::|:|..:.:.....|.|
plant   117 LEFE--YEKEIINSGVSAAEKEEVDSR----------SIYVGNV--DYACTPEEVQQHFQSCGTV 167

  Fly    66 YIMRYKIDFSGNSRGYAYLQYINVDLKESAM 96
            ..:....|..|..:|:||::::.|:..::::
plant   168 NRVTILTDKFGQPKGFAYVEFVEVEAVQNSL 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutNP_729346.1 RRM1_hnRNPR_like 36..115 CDD:240695 10/61 (16%)
DUF3388 <127..169 CDD:288701
PABN1NP_001190511.1 RRM <101..>265 CDD:223796 15/96 (16%)
RRM_II_PABPs 142..213 CDD:240752 10/59 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.