DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment tut and AT5G03580

DIOPT Version :9

Sequence 1:	NP_729346.1	Gene:	tut / 317996	FlyBaseID:	FBgn0052364	Length:	230	Species:	Drosophila melanogaster
Sequence 2:	NP_195978.1	Gene:	AT5G03580 / 831785	AraportID:	AT5G03580	Length:	101	Species:	Arabidopsis thaliana

Alignment Length:	60	Identity:	17/60 - (28%)
Similarity:	31/60 - (51%)	Gaps:	1/60 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly    60 SELGEVYIMRYKIDFSGNSRGYAYLQYINVDLKESAMQYLPMR-FRQLCMCLRVEPSTNN 118
            |:.|:|.......||.|.|||:|::::.:.|....||.::..| ..|..:|::..|...:
plant    38 SDFGKVIRSVLAKDFRGESRGFAFIEFESADSAGRAMLHMDGRLIGQKILCVQRTPKVED 97

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
tut	NP_729346.1	RRM1_hnRNPR_like	36..115	CDD:240695	16/55 (29%)
tut	NP_729346.1	DUF3388	<127..169	CDD:288701
AT5G03580	NP_195978.1	RRM_SF	19..90	CDD:240668	16/51 (31%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910