DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tut and AT3G52660

DIOPT Version :9

Sequence 1:NP_729346.1 Gene:tut / 317996 FlyBaseID:FBgn0052364 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001030849.1 Gene:AT3G52660 / 824432 AraportID:AT3G52660 Length:471 Species:Arabidopsis thaliana


Alignment Length:232 Identity:58/232 - (25%)
Similarity:94/232 - (40%) Gaps:62/232 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ELFLSCIPRNHS-------CSPRWIVEVASELGEVYIMRYKIDFSGNSRGYAYLQYINVDLKESA 95
            |::|..||.:.:       |..      ..|:.||.|||.|  .||:.:|||::.:.:.||...|
plant    93 EVYLGGIPTDATEGDLKGFCGS------IGEVTEVRIMREK--DSGDGKGYAFVTFRSKDLAAEA 149

  Fly    96 MQYL-PMRFRQLCMCLRVEPSTN--NRELVLKNVESSLRPWQVYQEMLKIHPFTIVRVYEYQLD- 156
            :..| ...||.    .|::.||.  ...|.|.||..:.....:.:...:|.|.  |::.|...: 
plant   150 IDTLNNTDFRG----KRIKCSTTQAKHRLFLGNVPRNWMESDIKKAANRIGPG--VQIVELPKEP 208

  Fly   157 ------QFFYIFEYRNNDSAASAHQRVRNSIRKFGEHA-HISWLTAENILSRASG---SFCFQ-- 209
                  :.|...||.|:..|..:.|::.|...|..::| .:||  ||   ||:.|   |...|  
plant   209 QNMGRNRGFAFIEYYNHACAEYSKQKMSNPSFKLDDNAPTVSW--AE---SRSGGGGDSSASQVK 268

  Fly   210 --------REVSQNRTRR------------VPPRQKG 226
                    |:::|.|.:.            :||.:.|
plant   269 ALYIKNLPRDITQERLKALFEHHGKILKVVIPPAKPG 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutNP_729346.1 RRM1_hnRNPR_like 36..115 CDD:240695 24/84 (29%)
DUF3388 <127..169 CDD:288701 8/48 (17%)
AT3G52660NP_001030849.1 RRM 94..165 CDD:214636 23/82 (28%)
RRM_SF 171..252 CDD:302621 19/84 (23%)
RRM_SF 267..346 CDD:302621 6/39 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0117
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.