DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tut and PAB6

DIOPT Version :9

Sequence 1:NP_729346.1 Gene:tut / 317996 FlyBaseID:FBgn0052364 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_188259.1 Gene:PAB6 / 820885 AraportID:AT3G16380 Length:537 Species:Arabidopsis thaliana


Alignment Length:165 Identity:37/165 - (22%)
Similarity:62/165 - (37%) Gaps:37/165 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LGEVYIMRYKIDFSGNSRGYAYLQYINVDLKESAMQYLPMRFRQLCMCLRVEPSTNNREL-VLKN 125
            :..|.:||   |..|.|||:.::.:.|.:..:.||:       .||..     ...:::| |.|.
plant   228 VSSVVVMR---DGMGRSRGFGFVNFCNPENAKKAME-------SLCGL-----QLGSKKLFVGKA 277

  Fly   126 VESSLRPWQVYQEMLKIHPFTIVRVYEYQLDQFF------YIFEYRNNDSAASAHQRVRNSIRKF 184
            ::...|     :|||| ..|:         |.|.      :...|..|.|.:....|:|.....:
plant   278 LKKDER-----REMLK-QKFS---------DNFIAKPNMRWSNLYVKNLSESMNETRLREIFGCY 327

  Fly   185 GEHAHISWLTAENILSRASGSFCFQREVSQNRTRR 219
            |:......:..||..|:..|..||.......:.:|
plant   328 GQIVSAKVMCHENGRSKGFGFVCFSNCEESKQAKR 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutNP_729346.1 RRM1_hnRNPR_like 36..115 CDD:240695 13/52 (25%)
DUF3388 <127..169 CDD:288701 10/47 (21%)
PAB6NP_188259.1 PABP-1234 22..477 CDD:130689 37/165 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.