DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tut and rbm19

DIOPT Version :9

Sequence 1:NP_729346.1 Gene:tut / 317996 FlyBaseID:FBgn0052364 Length:230 Species:Drosophila melanogaster
Sequence 2:XP_012825334.1 Gene:rbm19 / 733862 XenbaseID:XB-GENE-922190 Length:920 Species:Xenopus tropicalis


Alignment Length:238 Identity:44/238 - (18%)
Similarity:80/238 - (33%) Gaps:58/238 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ESKYCTSQVNGTITITTRKVLDENLKSLLDEGKGELFLSCI----PRNHSCSPRWIVEVASELGE 64
            ::...||:.....|..|::.:.|......:|.:.|....|.    ..|.|.|...:.|:.|::|.
 Frog   656 QTNQVTSEEQEADTADTKEEVKEMEVEDQEEDEEEALPGCTLFIKNLNFSTSEETLKEIFSKVGA 720

  Fly    65 V--YIMRYKIDFSGN--SRGYAYLQYINVDLKESAMQYLPMRFRQLCMC---------------L 110
            |  ..:..|.|.||:  ..|:.:::|...:..:.|:       |||..|               :
 Frog   721 VKSCSISKKKDKSGSLLPMGFGFVEYTKPEQAQKAL-------RQLQKCTVDGHQVEIKLSERAI 778

  Fly   111 RVEPSTNNRELVLKNVESSLRPWQVYQEMLKIHPF-TIVRVYEYQLDQF---------------- 158
            |...||..::...|..:||       :.:::..|| ..||........|                
 Frog   779 RAATSTERKKQNSKKQQSS-------KILVRNVPFQATVREIRELFSTFGELKTVRLPKKMAGTG 836

  Fly   159 ----FYIFEYRNNDSAASAHQRVRNSIRKFGEHAHISWLTAEN 197
                |...::.....|..|...:.:|...:|....:.|...|:
 Frog   837 SHRGFGFVDFVTKQDAKRAFSALCHSTHLYGRRLVLEWAETED 879

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutNP_729346.1 RRM1_hnRNPR_like 36..115 CDD:240695 21/101 (21%)
DUF3388 <127..169 CDD:288701 8/62 (13%)
rbm19XP_012825334.1 RRM1_RBM19 2..77 CDD:241008
RRM2_RMB19 279..350 CDD:240946
RRM3_RBM19 384..462 CDD:241011
RRM4_RBM19 570..641 CDD:241013
RRM5_RBM19_like 695..774 CDD:240764 19/85 (22%)
RRM6_RBM19 797..875 CDD:241015 11/84 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.