DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tut and A1cf

DIOPT Version :9

Sequence 1:NP_729346.1 Gene:tut / 317996 FlyBaseID:FBgn0052364 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001074543.1 Gene:A1cf / 69865 MGIID:1917115 Length:595 Species:Mus musculus


Alignment Length:168 Identity:44/168 - (26%)
Similarity:85/168 - (50%) Gaps:14/168 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ELFLSCIPRNHSCSPRWIVEVASELGEVYIMRYKIDFSGNSRGYAYLQYINVDLKESAMQYL--- 99
            |:|:..:||:  .....::.:..::|::|.||..:||:||:||||::.:.|....::|::.|   
Mouse    57 EIFIGKLPRD--LFEDELIPLCEKIGKIYEMRLMMDFNGNNRGYAFVTFSNKQEAKNAIKQLNNY 119

  Fly   100 PMRFRQLCMCLRVEPSTNNRELVLKNVESSLRPWQVYQEMLKIHPFTI-VRVYEYQLDQF----F 159
            .:|..:|   |.|..|.:|..|.:..:..:.:..::..||.|:....: |.||....|:.    |
Mouse   120 EIRTGRL---LGVCASVDNCRLFVGGIPKTKKREEILSEMKKVTEGVVDVIVYPSAADKTKNRGF 181

  Fly   160 YIFEYRNNDSAASAHQR-VRNSIRKFGEHAHISWLTAE 196
            ...||.::.:||.|.:| :...|:.:|....:.|...|
Mouse   182 AFVEYESHRAAAMARRRLLPGRIQLWGHPIAVDWAEPE 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutNP_729346.1 RRM1_hnRNPR_like 36..115 CDD:240695 23/79 (29%)
DUF3388 <127..169 CDD:288701 10/46 (22%)
A1cfNP_001074543.1 hnRNP-R-Q 2..595 CDD:273732 44/168 (26%)
Required for nuclear localization. /evidence=ECO:0000250|UniProtKB:Q9NQ94 360..409
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0117
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.