DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tut and elavl3

DIOPT Version :9

Sequence 1:NP_729346.1 Gene:tut / 317996 FlyBaseID:FBgn0052364 Length:230 Species:Drosophila melanogaster
Sequence 2:XP_012808614.1 Gene:elavl3 / 594912 XenbaseID:XB-GENE-490864 Length:363 Species:Xenopus tropicalis


Alignment Length:138 Identity:28/138 - (20%)
Similarity:58/138 - (42%) Gaps:38/138 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 DEGKGELFLSCIPRNHSCSPRWIVEVASELGEV---YIMRYKIDFSGNSRGYAYLQYINVDLKES 94
            |:.|..|.::.:|:|  .:......:...:||:   .::|.||  :|.|.||.::.|::.:..:.
 Frog    31 DDSKTNLIVNYLPQN--MTQEEFKSLFGSIGEIESCKLVRDKI--TGQSLGYGFVNYVDPNDADK 91

  Fly    95 AMQYLPMRFRQLCMCLRVEPSTNNRELVLKNVE--------SSLRPWQVYQEMLKIHPFTIVRVY 151
            |:..|                 |..:|..|.::        :|:|...:|...|   |.|   :.
 Frog    92 AINTL-----------------NGLKLQTKTIKVSYARPSSASIRDANLYVSSL---PKT---MN 133

  Fly   152 EYQLDQFF 159
            :.:::|.|
 Frog   134 QKEMEQLF 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutNP_729346.1 RRM1_hnRNPR_like 36..115 CDD:240695 16/81 (20%)
DUF3388 <127..169 CDD:288701 8/41 (20%)
elavl3XP_012808614.1 ELAV_HUD_SF 32..362 CDD:273741 27/137 (20%)
RRM1_Hu 34..111 CDD:241094 19/97 (20%)
RRM_SF 116..206 CDD:302621 8/32 (25%)
RRM3_HuC 279..363 CDD:241099
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.