DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tut and rbm46

DIOPT Version :9

Sequence 1:NP_729346.1 Gene:tut / 317996 FlyBaseID:FBgn0052364 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001073493.2 Gene:rbm46 / 566042 ZFINID:ZDB-GENE-061013-298 Length:523 Species:Danio rerio


Alignment Length:195 Identity:46/195 - (23%)
Similarity:90/195 - (46%) Gaps:33/195 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ELFLSCIPRNHSCSPRWIVEVASELGEVYIMRYKIDFSGNSRGYAYLQYINVDLKESAMQYL--- 99
            |:|:..|||:  .....:|.|..:.|.:|..|..::|||.:||||::.|...:..:.|:|.|   
Zfish    59 EVFVGKIPRD--MYEDELVPVFEQAGHIYEFRLMMEFSGENRGYAFVMYTTREKAQRAIQLLDNY 121

  Fly   100 ---PMRFRQLCMCLRVEPSTNNRELVLKNVESSLRPWQVYQEMLKIHPFTI-VRVYEYQLDQF-- 158
               |.:|..:|:      |.:|..|.:.::....:..::.:||:|:....: |.||...:|:.  
Zfish   122 EIRPGKFIGVCV------S
LDNCRLFIGSIPKDKKKEEIQEEMMKVTEGVMDVIVYPSAVDRMKN 180

  Fly   159 --FYIFEYRNNDSAASAHQR-VRNSIRKFGEHAHISWLTAENILSRASGSFCFQREVSQNRTRRV 220
              |...||.::.:||.|.:: :..:.:.:|....:.|...|             :|:.:...:||
Zfish   181 RGFAFVEYESHKAAAMARRKLIPGTFQLWGHTIQVDWAEPE-------------KELDEETMQRV 232

  Fly   221  220
            Zfish   233  232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutNP_729346.1 RRM1_hnRNPR_like 36..115 CDD:240695 24/82 (29%)
DUF3388 <127..169 CDD:288701 10/46 (22%)
rbm46NP_001073493.2 RRM1_RBM46 58..134 CDD:240928 24/82 (29%)
RRM2_RBM46 136..220 CDD:240936 17/83 (20%)
RRM_SF 225..305 CDD:302621 2/8 (25%)
DND1_DSRM 392..463 CDD:291380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0117
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.