DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tut and a1cf

DIOPT Version :9

Sequence 1:NP_729346.1 Gene:tut / 317996 FlyBaseID:FBgn0052364 Length:230 Species:Drosophila melanogaster
Sequence 2:XP_009304711.1 Gene:a1cf / 562916 ZFINID:ZDB-GENE-060824-3 Length:550 Species:Danio rerio


Alignment Length:182 Identity:45/182 - (24%)
Similarity:79/182 - (43%) Gaps:34/182 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 EGKGELFLSCIPRNHSCSPRWIVEVASELGEVYIMRYKIDFSGNSRGYAYLQYINVDLKESAMQ- 97
            |...|:|:..:||:  .....:|.:..:.|::|.:|..:||:||:||||::.:......::||: 
Zfish    53 ERGSEIFVGKLPRD--LFEDELVPLCEKFGKIYEVRMMMDFNGNNRGYAFVTFSTKQEAKNAMKQ 115

  Fly    98 ---YLPMRFRQLCMCLRVE---------PSTNNRELVLKNVESSLRPWQVYQEMLKIHPFTI-VR 149
               |.....|.|.:|..|:         |.|..||             ::..||.|:....: |.
Zfish   116 LNNYEIRNGRLLGVCASVDNCRLFVGGIPKTKKRE-------------EILAEMKKVTDGVLDVI 167

  Fly   150 VYEYQLDQF----FYIFEYRNNDSAASAHQR-VRNSIRKFGEHAHISWLTAE 196
            ||....|:.    |...||..:.:||.|.:: :...|:.:|....:.|...|
Zfish   168 VYPSAADKAKNRGFAFVEYETHRAAAMARRKLLPGRIQLWGHPIAVDWAEPE 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutNP_729346.1 RRM1_hnRNPR_like 36..115 CDD:240695 23/91 (25%)
DUF3388 <127..169 CDD:288701 10/46 (22%)
a1cfXP_009304711.1 hnRNP-R-Q 6..534 CDD:273732 45/182 (25%)
RRM_SF 55..132 CDD:302621 22/78 (28%)
RRM_SF 134..218 CDD:302621 20/96 (21%)
RRM3_ACF 223..305 CDD:240942
DND1_DSRM 451..529 CDD:291380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.