DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tut and RBM47

DIOPT Version :9

Sequence 1:NP_729346.1 Gene:tut / 317996 FlyBaseID:FBgn0052364 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001092104.1 Gene:RBM47 / 54502 HGNCID:30358 Length:593 Species:Homo sapiens


Alignment Length:213 Identity:48/213 - (22%)
Similarity:89/213 - (41%) Gaps:48/213 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ELFLSCIPRNHSCSPRWIVEVASELGEVYIMRYKIDFSGNSRGYAYLQYINVDLKESAMQYL--- 99
            |:|:..|||:  .....:|.|...:|.:|.:|..:||.|.:||||::.|.:....:.|::.|   
Human    72 EVFVGKIPRD--VYEDELVPVFEAVGRIYELRLMMDFDGKNRGYAFVMYCHKHEAKRAVRELNNY 134

  Fly   100 ---PMRFRQLCMCLRVEPSTNNRELVLKNVESSLRPWQVYQEMLKIHPFTI-VRVYEYQLDQF-- 158
               |.|...:| |     |.:|..|.:..:....:..::.:|:.|:....: |.||....|:.  
Human   135 EIRPGRLLGVC-C-----SVDNCRLFIGGIPKMKKREEILEEIAKVTEGVLDVIVYASAADKMKN 193

  Fly   159 --FYIFEYRNNDSAASAHQRVR-NSIRKFGEHAHISWL-------------------------TA 195
              |...||.::.:||.|.:::. ..|:.:|....:.|.                         |.
Human   194 RGFAFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETT 258

  Fly   196 ENILSRASGSF---CFQR 210
            |:.:.::.|.|   |.:|
Human   259 EDTIKKSFGQFNPGCVER 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutNP_729346.1 RRM1_hnRNPR_like 36..115 CDD:240695 24/82 (29%)
DUF3388 <127..169 CDD:288701 9/46 (20%)
RBM47NP_001092104.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
hnRNP-R-Q 21..593 CDD:273732 48/213 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0117
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.