DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tut and srsf9

DIOPT Version :9

Sequence 1:NP_729346.1 Gene:tut / 317996 FlyBaseID:FBgn0052364 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001004795.1 Gene:srsf9 / 448015 XenbaseID:XB-GENE-491310 Length:225 Species:Xenopus tropicalis


Alignment Length:51 Identity:11/51 - (21%)
Similarity:23/51 - (45%) Gaps:12/51 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 SGNSRGYAYLQYINVDLKESAMQYLPMRFRQLCMCLRVEPSTNNRELVLKN 125
            :|:..|..|:..:..|::|..::.|..|:.::            |.:.|||
 Frog    11 TGSGDGRIYVGNLPADIREKELEDLFDRYGRI------------RTIELKN 49

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutNP_729346.1 RRM1_hnRNPR_like 36..115 CDD:240695 7/39 (18%)
DUF3388 <127..169 CDD:288701
srsf9NP_001004795.1 RRM_SF 17..90 CDD:388407 9/45 (20%)
RRM2_SRSF9 117..191 CDD:241212
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.