DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment tut and srsf9

DIOPT Version :9

Sequence 1:	NP_729346.1	Gene:	tut / 317996	FlyBaseID:	FBgn0052364	Length:	230	Species:	Drosophila melanogaster
Sequence 2:	NP_001004795.1	Gene:	srsf9 / 448015	XenbaseID:	XB-GENE-491310	Length:	225	Species:	Xenopus tropicalis

Alignment Length:	51	Identity:	11/51 - (21%)
Similarity:	23/51 - (45%)	Gaps:	12/51 - (23%)

- Green bases have known domain annotations that are detailed below.

  Fly    75 SGNSRGYAYLQYINVDLKESAMQYLPMRFRQLCMCLRVEPSTNNRELVLKN 125
            :|:..|..|:..:..|::|..::.|..|:.::            |.:.|||
Frog    11 TGSGDGRIYVGNLPADIREKELEDLFDRYGRI------------RTIELKN 49

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
tut	NP_729346.1	RRM1_hnRNPR_like	36..115	CDD:240695	7/39 (18%)
tut	NP_729346.1	DUF3388	<127..169	CDD:288701
srsf9	NP_001004795.1	RRM_SF	17..90	CDD:388407	9/45 (20%)
srsf9	NP_001004795.1	RRM2_SRSF9	117..191	CDD:241212
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910