DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tut and Elavl4

DIOPT Version :9

Sequence 1:NP_729346.1 Gene:tut / 317996 FlyBaseID:FBgn0052364 Length:230 Species:Drosophila melanogaster
Sequence 2:XP_006238653.1 Gene:Elavl4 / 432358 RGDID:1560027 Length:393 Species:Rattus norvegicus


Alignment Length:136 Identity:31/136 - (22%)
Similarity:55/136 - (40%) Gaps:34/136 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 DEGKGELFLSCIPRNHSCSP-RWIVEVASELGEVYIMRYKIDFSGNSRGYAYLQYINVDLKESAM 96
            |:.|..|.::.:|:|.:... |.:.....|:....::|.||  :|.|.||.::.||:....|.|:
  Rat    55 DDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKI--TGQSLGYGFVNYIDPKDAEKAI 117

  Fly    97 QYLPMRFRQLCMCLRVEPSTNNRELVLKNVE--------SSLRPWQVYQEMLKIHPFTIVRVYEY 153
            ..|                 |...|..|.::        :|:|...:|...|   |.|:.   :.
  Rat   118 NTL-----------------NGLRLQTKTIKVSYARPSSASIRDANLYVSGL---PKTMT---QK 159

  Fly   154 QLDQFF 159
            :|:|.|
  Rat   160 ELEQLF 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutNP_729346.1 RRM1_hnRNPR_like 36..115 CDD:240695 18/79 (23%)
DUF3388 <127..169 CDD:288701 9/41 (22%)
Elavl4XP_006238653.1 ELAV_HUD_SF 56..392 CDD:273741 30/135 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.