DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tut and elavl2

DIOPT Version :9

Sequence 1:NP_729346.1 Gene:tut / 317996 FlyBaseID:FBgn0052364 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001002172.2 Gene:elavl2 / 431719 ZFINID:ZDB-GENE-040704-9 Length:389 Species:Danio rerio


Alignment Length:166 Identity:35/166 - (21%)
Similarity:67/166 - (40%) Gaps:39/166 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CTSQVNGTITITTRKVLDENLKSLLDEGKGELFLSCIPRNHSCSPRWIVEVASELGEV---YIMR 69
            |||. ||..:::........:.:..::.|..|.::.:|:|  .:...:..:...:||:   .::|
Zfish    40 CTSS-NGPNSVSNTCTSPVEMPNGSEDSKTNLIVNYLPQN--MTQEELKSLFGSIGEIESCKLVR 101

  Fly    70 YKIDFSGNSRGYAYLQYINVDLKESAMQYLPMRFRQLCMCLRVEPSTNNRELVLKNVE------- 127
            .||  :|.|.||.::.|:.....|.|:..|                 |...|..|.::       
Zfish   102 DKI--TGQSLGYGFVNYMEPKDAEKAINTL-----------------NGLRLQTKTIKVSYARPS 147

  Fly   128 -SSLRPWQVYQEMLKIHPFTIVRVYEYQLDQFFYIF 162
             :|:|...:|...|   |.|:.   :.:|:|.|..|
Zfish   148 SASIRDANLYVSGL---PKTMT---QKELEQLFSQF 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutNP_729346.1 RRM1_hnRNPR_like 36..115 CDD:240695 17/81 (21%)
DUF3388 <127..169 CDD:288701 10/44 (23%)
elavl2NP_001002172.2 ELAV_HUD_SF 65..388 CDD:273741 30/140 (21%)
RRM1_Hu 67..144 CDD:241094 20/97 (21%)
RRM2_HuB 149..238 CDD:241219 10/35 (29%)
RRM_SF 303..388 CDD:302621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.