DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tut and hnrnpr

DIOPT Version :9

Sequence 1:NP_729346.1 Gene:tut / 317996 FlyBaseID:FBgn0052364 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_998591.1 Gene:hnrnpr / 406735 ZFINID:ZDB-GENE-040426-2766 Length:214 Species:Danio rerio


Alignment Length:123 Identity:30/123 - (24%)
Similarity:45/123 - (36%) Gaps:28/123 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 NNRELVLKNVESSLRPWQV-------YQEMLKIH-PFTIVRVYEYQLDQFFYIFEYRNNDSAASA 173
            |...::||..|   .|.:|       ||.:|... |..:..    .||..|...|...:...|.|
Zfish     6 NGSSVLLKEEE---EPMEVTAPRSENYQALLDAGLPQKVAE----SLDNIFQTGESAEHGLVAYA 63

  Fly   174 --HQRVRNSIRKFGEHAHISWLT--AENILSRASGSFCF---------QREVSQNRTR 218
              .:|..:::|:|.|...:|.|.  .|:.||.......|         |||...|:.:
Zfish    64 DLDERALDALREFNEEGALSVLQQFKESDLSHVQNKSAFLCGVMKTYRQREKQGNKVQ 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutNP_729346.1 RRM1_hnRNPR_like 36..115 CDD:240695
DUF3388 <127..169 CDD:288701 11/49 (22%)
hnrnprNP_998591.1 RRM_SF 169..>200 CDD:302621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0117
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.