DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tut and Elavl1

DIOPT Version :9

Sequence 1:NP_729346.1 Gene:tut / 317996 FlyBaseID:FBgn0052364 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001102318.1 Gene:Elavl1 / 363854 RGDID:1308649 Length:326 Species:Rattus norvegicus


Alignment Length:224 Identity:39/224 - (17%)
Similarity:78/224 - (34%) Gaps:71/224 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ESKYCTSQVNG------TITITTRKVLDENLKSLLDEGKGELFLSCIPRNHSCSPRWIVEVASEL 62
            :::...|.:||      ||.::..:...|.:|.      ..|::|.:||  :.:.:.:.::.|..
  Rat    73 DAERAISTLNGLRLQSKTIKVSYARPSSEVIKD------ANLYISGLPR--TMTQKDVEDMFSRF 129

  Fly    63 GEVYIMRYKID-FSGNSRGYAYLQYINVDLKESAMQYL--------PMRFRQLCMCLRVEPSTNN 118
            |.:...|..:| .:|.|||.|::::   |.:..|.:.:        |.....:.:.....|:.|.
  Rat   130 GRIINSRVLVDQTTGLSRGVAFIRF---DKRSEAEEAITSFNGHKPPGSSEPITVKFAANPNQNK 191

  Fly   119 RELVLKNVESSLRPWQVYQEMLK-----IHPFTIVRVYEYQLDQFFYIFEYRNNDSAASAHQRVR 178
            ...:|.         |:|....:     :|                              ||..|
  Rat   192 NMALLS---------QLYHSPARRFGGPVH------------------------------HQAQR 217

  Fly   179 NSIRKFGEHAHISWLTAENILSRASGSFC 207
            ......|.. |:|.::..|:...||..:|
  Rat   218 FRFSPMGVD-HMSGISGVNVPGNASSGWC 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutNP_729346.1 RRM1_hnRNPR_like 36..115 CDD:240695 16/87 (18%)
DUF3388 <127..169 CDD:288701 3/46 (7%)
Elavl1NP_001102318.1 ELAV_HUD_SF 19..326 CDD:273741 39/224 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.