DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tut and syncrip

DIOPT Version :9

Sequence 1:NP_729346.1 Gene:tut / 317996 FlyBaseID:FBgn0052364 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_999861.1 Gene:syncrip / 326663 ZFINID:ZDB-GENE-030131-4862 Length:630 Species:Danio rerio


Alignment Length:273 Identity:56/273 - (20%)
Similarity:100/273 - (36%) Gaps:86/273 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YCTSQVNGTITITTRKVLDENLKSLLDEGKG------------------------------ELFL 41
            |...:..||..:.:.|..||....:|.|..|                              |:|:
Zfish   102 YRQREKQGTKVVESTKGPDEAKIKILLERTGYTLDVTTGQRKYGGPPPESVYTGAQPTVGTEIFV 166

  Fly    42 SCIPRN---HSCSPRWIVEVASELGEVYIMRYKID-FSGNSRGYAYLQYINVDLKESAMQYLPMR 102
            ..|||:   ....|::     .:.|.::.:|..:| .||.:||||:|.:..   ||:|.:.:   
Zfish   167 GKIPRDLFEDELVPQF-----EKAGPIWDLRLMMDPLSGLNRGYAFLTFCT---KEAAQEAV--- 220

  Fly   103 FRQLCMCLRVEP--------STNNRELVLKNVESSLRPWQVYQEMLKI-HPFTIVRVY----EYQ 154
              :||....:.|        |..|..|.:.::..|....|:.:|..|: ...|.|.:|    :.:
Zfish   221 --KLCNNHEIRPGKHIGVCISVANNRLFVGSIPKSKTKEQIVEEFSKVTEGLTDVILYHQPDDKK 283

  Fly   155 LDQFFYIFEYRNNDSAASAHQRVRN-SIRKFGEHAHISWL------------------------- 193
            .::.|...||.::.:||.|.:|:.: .::.:|....:.|.                         
Zfish   284 KNRGFCFLEYEDHKTAAQARRRLMSGKVKVWGNLVTVEWADPIEDPDPEVMAKVKVLFVRNLANS 348

  Fly   194 TAENILSRASGSF 206
            ..|.||.:|.|.|
Zfish   349 VTEEILEKAFGQF 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutNP_729346.1 RRM1_hnRNPR_like 36..115 CDD:240695 23/120 (19%)
DUF3388 <127..169 CDD:288701 10/46 (22%)
syncripNP_999861.1 hnRNP-R-Q 103..622 CDD:273732 55/272 (20%)
RRM1_hnRNPQ 161..239 CDD:240927 22/90 (24%)
RRM2_hnRNPQ 241..325 CDD:240933 18/83 (22%)
RRM3_hnRNPQ 337..408 CDD:240939 6/25 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0117
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.