DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tut and syncripl

DIOPT Version :9

Sequence 1:NP_729346.1 Gene:tut / 317996 FlyBaseID:FBgn0052364 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_955973.1 Gene:syncripl / 324384 ZFINID:ZDB-GENE-030131-3104 Length:560 Species:Danio rerio


Alignment Length:170 Identity:38/170 - (22%)
Similarity:78/170 - (45%) Gaps:25/170 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ELFLSCIPRNHSCSPRWIVEVASELGEVYIMRYKID-FSGNSRGYAYLQYINVDLKESAMQYLPM 101
            |:|:..|||:  .....:|.:..:.|.::.:|..:| .||.:||||::.:..   ||:|.:.:  
Zfish   164 EIFVGKIPRD--LFEDELVPLFEKAGPIWDLRLMMDPLSGLNRGYAFVTFCT---KEAAQKAV-- 221

  Fly   102 RFRQLCMCLRVEP--------STNNRELVLKNVESSLRPWQVYQEMLKI-HPFTIVRVY----EY 153
               :||....:.|        |..|..|.:.::..|....|:.:|..|: .....|.:|    :.
Zfish   222 ---KLCNNNEIRPGKHIGVCIS
VANNRLFVGSIPKSKTKDQIVEEFAKVTEGLNDVILYHQPDDK 283

  Fly   154 QLDQFFYIFEYRNNDSAASAHQRVRN-SIRKFGEHAHISW 192
            :.::.|....|.::.:||.|.:|:.: .::.:|....:.|
Zfish   284 KKNRGFCFLGYEDHKTAAQARRRLMSGKVKVWGNVVTVEW 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutNP_729346.1 RRM1_hnRNPR_like 36..115 CDD:240695 21/85 (25%)
DUF3388 <127..169 CDD:288701 8/46 (17%)
syncriplNP_955973.1 RRM1_hnRNPQ 162..240 CDD:240927 21/85 (25%)
RRM_SF 242..326 CDD:302621 16/82 (20%)
RRM3_hnRNPR 338..409 CDD:240938
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0117
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.