DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tut and Hnrnpr

DIOPT Version :9

Sequence 1:NP_729346.1 Gene:tut / 317996 FlyBaseID:FBgn0052364 Length:230 Species:Drosophila melanogaster
Sequence 2:XP_038966069.1 Gene:Hnrnpr / 319110 RGDID:631348 Length:635 Species:Rattus norvegicus


Alignment Length:202 Identity:48/202 - (23%)
Similarity:93/202 - (46%) Gaps:34/202 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 TITITT--RKV---LDENLKSLLDEGKG-ELFLSCIPRNHSCSPRWIVEVASELGEVYIMRYKID 73
            |:.:||  ||.   ..:::.|.:..|.| |:|:..|||:  .....:|.:..:.|.::.:|..:|
  Rat   137 TLDVTTGQRKYGGPPPDSVYSGVQPGIGTEVFVGKIPRD--LYEDELVPLFEKAGPIWDLRLMMD 199

  Fly    74 -FSGNSRGYAYLQYINVDLKESAMQYLPMRFRQLCMCLRVEP--------STNNRELVLKNVESS 129
             .||.:||||::.:..   ||:|.:.:     :||....:.|        |..|..|.:.::..:
  Rat   200 PLSGQNRGYAFITFCG---KEAAQEAV-----KLCDSYEIRPGKHLGVCISVANNRLFVGSIPKN 256

  Fly   130 LRPWQVYQEMLKIHPFT--IVRVYEY------QLDQFFYIFEYRNNDSAASAHQRVRN-SIRKFG 185
            .....:.:|..|:...|  :|.|..|      :.::.|...||.::.|||.|.:|:.: .::.:|
  Rat   257 KTKENILEEFSKVTGLTEGLVDVILYHQPDDKKKNRGFCFLEYEDHKSAAQARRRLMSGKVKVWG 321

  Fly   186 EHAHISW 192
            ....:.|
  Rat   322 NVVTVEW 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutNP_729346.1 RRM1_hnRNPR_like 36..115 CDD:240695 22/88 (25%)
DUF3388 <127..169 CDD:288701 9/49 (18%)
HnrnprXP_038966069.1 NURR_hnRNPR 27..110 CDD:410955
hnRNP-R-Q 106..630 CDD:273732 48/202 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0117
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.