DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tut and elavl3

DIOPT Version :9

Sequence 1:NP_729346.1 Gene:tut / 317996 FlyBaseID:FBgn0052364 Length:230 Species:Drosophila melanogaster
Sequence 2:XP_009298008.1 Gene:elavl3 / 30732 ZFINID:ZDB-GENE-980526-76 Length:366 Species:Danio rerio


Alignment Length:94 Identity:22/94 - (23%)
Similarity:42/94 - (44%) Gaps:16/94 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 TSQVNGTITITTRKVLDENLKSLLDEGKGELFLSCIPRNHSCSPRWIVEVASELGEV---YIMRY 70
            ||..||.:..|         ....|:.|..|.::.:|:|  .:......:...:||:   .::|.
Zfish    19 TSLPNGPVIST---------NGATDDSKTNLIVNYLPQN--MTQEEFKSLFGSIGEIESCKLVRD 72

  Fly    71 KIDFSGNSRGYAYLQYINVDLKESAMQYL 99
            ||  :|.|.||.::.|::.:..:.|:..|
Zfish    73 KI--TGQSLGYGFVNYVDPNDADKAINTL 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutNP_729346.1 RRM1_hnRNPR_like 36..115 CDD:240695 16/67 (24%)
DUF3388 <127..169 CDD:288701
elavl3XP_009298008.1 ELAV_HUD_SF 35..365 CDD:273741 16/69 (23%)
RRM1_Hu 37..114 CDD:241094 16/67 (24%)
RRM_SF 119..209 CDD:302621
RRM3_HuC 282..366 CDD:241099
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.