DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tut and A1CF

DIOPT Version :9

Sequence 1:NP_729346.1 Gene:tut / 317996 FlyBaseID:FBgn0052364 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001185748.1 Gene:A1CF / 29974 HGNCID:24086 Length:602 Species:Homo sapiens


Alignment Length:208 Identity:50/208 - (24%)
Similarity:89/208 - (42%) Gaps:54/208 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LKSLLDEGKG--------------------ELFLSCIPRNHSCSPRWIVEVASELGEVYIMRYKI 72
            |::||::..|                    |:|:..:||:  .....::.:..::|::|.||..:
Human    35 LQTLLEKENGQRKYGGPPPGWDAAPPERGCEIFIGKLPRD--LFEDELIPLCEKIGKIYEMRMMM 97

  Fly    73 DFSGNSRGYAYLQYIN-VDLKESAMQ---YLPMRFRQLCMCLRVE---------PSTNNRELVLK 124
            ||:||:||||::.:.| |:.|.:..|   |.....|.|.:|..|:         |.|..||    
Human    98 DFNGNNRGYAFVTFSNKVEAKNAIKQLNNYEIRNGRLLGVCASVDNCRLFVGGIPKTKKRE---- 158

  Fly   125 NVESSLRPWQVYQEMLKIHPFTI-VRVYEYQLDQF----FYIFEYRNNDSAASAHQR-VRNSIRK 183
                     ::..||.|:....: |.||....|:.    |...||.::.:||.|.:: :...|:.
Human   159 ---------EILSEMKKVTEGVVDVIVYPSAADKTKNRGFAFVEYESHRAAAMARRKLLPGRIQL 214

  Fly   184 FGEHAHISWLTAE 196
            :|....:.|...|
Human   215 WGHGIAVDWAEPE 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutNP_729346.1 RRM1_hnRNPR_like 36..115 CDD:240695 26/111 (23%)
DUF3388 <127..169 CDD:288701 10/46 (22%)
A1CFNP_001185748.1 hnRNP-R-Q 29..602 CDD:273732 50/208 (24%)
RRM1_ACF 63..140 CDD:240930 24/78 (31%)
RRM2_ACF 142..226 CDD:240934 20/96 (21%)
RRM3_ACF 231..313 CDD:240942
DND1_DSRM 455..531 CDD:291380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0117
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.