DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tut and bru2

DIOPT Version :9

Sequence 1:NP_729346.1 Gene:tut / 317996 FlyBaseID:FBgn0052364 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001036356.1 Gene:bru2 / 250811 FlyBaseID:FBgn0262475 Length:893 Species:Drosophila melanogaster


Alignment Length:115 Identity:20/115 - (17%)
Similarity:42/115 - (36%) Gaps:23/115 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 LRVEPSTNNRELVLKNV-----ESSLRPWQVYQEMLKIHPFTIVRVYEYQLDQFFYIFEYRNNDS 169
            ::.:|..:|.::.:..:     |:.||  |::::...:|...::|.....:.:......|....:
  Fly   286 IKDQPDADNIKMFVGQIPKTWDETRLR--QMFEQFGPVHTLNVLRDKVTSISRGCCFVTYYTRKA 348

  Fly   170 AASAHQRVRNSIRKFGEHAHISWLTAENILSRASGSFCFQREVSQNRTRR 219
            |..|...:.|.....|.|..|....|:                |:||..|
  Fly   349 ALRAQDALHNIKTLDGMHHPIQMKPAD----------------SENRNER 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutNP_729346.1 RRM1_hnRNPR_like 36..115 CDD:240695 0/4 (0%)
DUF3388 <127..169 CDD:288701 7/41 (17%)
bru2NP_001036356.1 RRM1_CELF1_2_Bruno 294..375 CDD:241075 14/82 (17%)
RRM2_Bruno_like 381..461 CDD:241080 1/2 (50%)
RRM_SF 801..892 CDD:302621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.