DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tut and Dnd1

DIOPT Version :9

Sequence 1:NP_729346.1 Gene:tut / 317996 FlyBaseID:FBgn0052364 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_775559.2 Gene:Dnd1 / 213236 MGIID:2447763 Length:352 Species:Mus musculus


Alignment Length:198 Identity:48/198 - (24%)
Similarity:88/198 - (44%) Gaps:26/198 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ELFLSCIPRN---HSCSPRWIVEVASELGEVYIMRYKIDFSGNSRGYAYLQYINVDLKESAMQYL 99
            |:::..:|::   |.     ::.:...:|.:|..|..:.|||.:||:||.:|.:....::|:..|
Mouse    59 EVYIGRLPQDVYEHQ-----LIPLFQRVGRLYEFRLMMTFSGLNRGFAYARYSSRRGAQAAIATL 118

  Fly   100 -PMRFRQLCMCLRVEPSTNNRELVLKNVESSLRPWQVYQEMLKIHPF------TIVRVYEYQLDQ 157
             ..:.|..|..| |..||...||.:..:..||....:   :|.:.||      |::.........
Mouse   119 HNHQLRPSCQLL-VCRS
TEKCELTVDGLPLSLNRRAL---LLALQPFGPCLQETLLLPSPGSAPS 179

  Fly   158 FFYIFEYRNNDSAASAHQR-VRNSIRKFGEHAHISWL---TAENILSRASG-SFCFQR-EVSQ-N 215
            ...:.::..:.:||.|.:. |....|..||...:.||   ..::...:.:| |..|.| :||| .
Mouse   180 QIALLKFSTHRAAAMAKKALVEGQSRLCGEQVAVEWLKPDLKQHFRQQLAGPSLRFLRPDVSQLT 244

  Fly   216 RTR 218
            :||
Mouse   245 QTR 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutNP_729346.1 RRM1_hnRNPR_like 36..115 CDD:240695 20/80 (25%)
DUF3388 <127..169 CDD:288701 6/47 (13%)
Dnd1NP_775559.2 RRM1_DND1 57..134 CDD:240931 20/80 (25%)
RRM_SF 136..218 CDD:302621 17/84 (20%)
DND1_DSRM 253..333 CDD:291380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0117
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.