DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tut and ELAVL4

DIOPT Version :9

Sequence 1:NP_729346.1 Gene:tut / 317996 FlyBaseID:FBgn0052364 Length:230 Species:Drosophila melanogaster
Sequence 2:XP_011539191.1 Gene:ELAVL4 / 1996 HGNCID:3315 Length:416 Species:Homo sapiens


Alignment Length:182 Identity:38/182 - (20%)
Similarity:68/182 - (37%) Gaps:51/182 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ESKYCTSQV---------NGTITITTRKVLDENLK--------SLLDEGKGELFLSCIPRNHSCS 51
            ||:.|:..:         ||..:.|:......|..        :..|:.|..|.::.:|:|.:..
Human    32 ESRNCSFMIISTMEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSKTNLIVNYLPQNMTQE 96

  Fly    52 P-RWIVEVASELGEVYIMRYKIDFSGNSRGYAYLQYINVDLKESAMQYLPMRFRQLCMCLRVEPS 115
            . |.:.....|:....::|.||  :|.|.||.::.||:....|.|:..|                
Human    97 EFRSLFGSIGEIESCKLVRDKI--TGQSLGYGFVNYIDPKDAEKAINTL---------------- 143

  Fly   116 TNNRELVLKNVE--------SSLRPWQVYQEMLKIHPFTIVRVYEYQLDQFF 159
             |...|..|.::        :|:|...:|...|   |.|:.   :.:|:|.|
Human   144 -NGLRLQTKTIKVSYARPSSASIRDANLYVSGL---PKTMT---QKELEQLF 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutNP_729346.1 RRM1_hnRNPR_like 36..115 CDD:240695 18/79 (23%)
DUF3388 <127..169 CDD:288701 9/41 (22%)
ELAVL4XP_011539191.1 ELAV_HUD_SF 79..415 CDD:273741 30/135 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.