DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tut and ELAVL3

DIOPT Version :9

Sequence 1:NP_729346.1 Gene:tut / 317996 FlyBaseID:FBgn0052364 Length:230 Species:Drosophila melanogaster
Sequence 2:XP_024307178.1 Gene:ELAVL3 / 1995 HGNCID:3314 Length:424 Species:Homo sapiens


Alignment Length:211 Identity:39/211 - (18%)
Similarity:78/211 - (36%) Gaps:65/211 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 DEGKGELFLSCIPRNHSCSPRWIVEVASELGEV------YIMRYKIDFSGNSRGYAYLQYINVDL 91
            |:.|..|.::.:|:|.:..     |..|..|.:      .::|.||  :|.|.||.::.|.:.:.
Human    35 DDSKTNLIVNYLPQNMTQD-----EFKSLFGSIGDIESCKLVRDKI--TGQSLGYGFVNYSDPND 92

  Fly    92 KESAMQYLPMRFRQLCMCLRVEPSTNNRELVLKNVE--------SSLRPWQVYQEMLKIHPFTIV 148
            .:.|:..|                 |..:|..|.::        :|:|...:|...|   |.|  
Human    93 ADKAINTL-----------------NGLKLQTKTIKVSYARPSSASIRDANLYVSGL---PKT-- 135

  Fly   149 RVYEYQLDQFFYIFEYRNNDSAASAHQRVRNSIRKFGEHAHISWLTAENILSRASGSFCFQRE-- 211
             :.:.:::|.|            |.:.|:..|      ...:..:|.:.:...|.|....||:  
Human   136 -MSQKEMEQLF------------SQYGRIITS------RILVDQVTGQAVREGAPGGGAGQRQSG 181

  Fly   212 -VSQNRTRRVPPRQKG 226
             .:..:..::|..:.|
Human   182 GTNVGKPTKMPGHEAG 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutNP_729346.1 RRM1_hnRNPR_like 36..115 CDD:240695 17/84 (20%)
DUF3388 <127..169 CDD:288701 8/49 (16%)
ELAVL3XP_024307178.1 RRM 36..423 CDD:330708 38/210 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.