Sequence 1: | NP_729346.1 | Gene: | tut / 317996 | FlyBaseID: | FBgn0052364 | Length: | 230 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001410.2 | Gene: | ELAVL1 / 1994 | HGNCID: | 3312 | Length: | 326 | Species: | Homo sapiens |
Alignment Length: | 226 | Identity: | 38/226 - (16%) |
---|---|---|---|
Similarity: | 78/226 - (34%) | Gaps: | 75/226 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 ESKYCTSQVNG------TITITTRKVLDENLKSLLDEGKGELFLSCIPRNHSCSPRWIVEVASEL 62
Fly 63 GEVYIMRYKID-FSGNSRGYAYLQYINVDLKESAMQYLPMRFRQLCMCLRVEPSTNNRELVLKNV 126
Fly 127 ESSLRPWQVYQEMLKIHPFTIVRVYEYQLDQFFYIFEYRNNDSAASAHQRVRNSIRKFG---EHA 188
Fly 189 ------------HISWLTAENILSRASGSFC 207 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
tut | NP_729346.1 | RRM1_hnRNPR_like | 36..115 | CDD:240695 | 15/79 (19%) |
DUF3388 | <127..169 | CDD:288701 | 4/41 (10%) | ||
ELAVL1 | NP_001410.2 | ELAV_HUD_SF | 19..326 | CDD:273741 | 38/226 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |