DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tut and ELAVL1

DIOPT Version :9

Sequence 1:NP_729346.1 Gene:tut / 317996 FlyBaseID:FBgn0052364 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001410.2 Gene:ELAVL1 / 1994 HGNCID:3312 Length:326 Species:Homo sapiens


Alignment Length:226 Identity:38/226 - (16%)
Similarity:78/226 - (34%) Gaps:75/226 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ESKYCTSQVNG------TITITTRKVLDENLKSLLDEGKGELFLSCIPRNHSCSPRWIVEVASEL 62
            :::...:.:||      ||.::..:...|.:|.      ..|::|.:||  :.:.:.:.::.|..
Human    73 DAERAINTLNGLRLQSKTIKVSYARPSSEVIKD------ANLYISGLPR--TMTQKDVEDMFSRF 129

  Fly    63 GEVYIMRYKID-FSGNSRGYAYLQYINVDLKESAMQYLPMRFRQLCMCLRVEPSTNNRELVLKNV 126
            |.:...|..:| .:|.|||.|::::   |.:..|                               
Human   130 GRIINSRVLVDQTTGLSRGVAFIRF---DKRSEA------------------------------- 160

  Fly   127 ESSLRPWQVYQEMLKIHPFTIVRVYEYQLDQFFYIFEYRNNDSAASAHQRVRNSIRKFG---EHA 188
            |.::..:..::......|.|:.           :......|.:.|...|...:..|:||   .|.
Human   161 EEAITSFNGHKPPGSSEPITVK-----------FAANPNQNKNVALLSQLYHSPARRFGGPVHHQ 214

  Fly   189 ------------HISWLTAENILSRASGSFC 207
                        |:|.|:..|:...||..:|
Human   215 AQRFRFSPMGVDHMSGLSGVNVPGNASSGWC 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutNP_729346.1 RRM1_hnRNPR_like 36..115 CDD:240695 15/79 (19%)
DUF3388 <127..169 CDD:288701 4/41 (10%)
ELAVL1NP_001410.2 ELAV_HUD_SF 19..326 CDD:273741 38/226 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.