DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tut and hrpr-1

DIOPT Version :9

Sequence 1:NP_729346.1 Gene:tut / 317996 FlyBaseID:FBgn0052364 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_493049.2 Gene:hrpr-1 / 173086 WormBaseID:WBGene00002000 Length:611 Species:Caenorhabditis elegans


Alignment Length:250 Identity:52/250 - (20%)
Similarity:101/250 - (40%) Gaps:73/250 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ESKYCTSQV---------NGTITITTRKVLD----ENLKSLLD---------------------- 33
            :|.|.||.:         .|...:|:.|:::    ..||:||:                      
 Worm   124 KSLYVTSLIRSFKDRCRQQGAAAVTSGKLINGPELAALKNLLETTGYTIEVTIGQRKFGGPPPDW 188

  Fly    34 -------EGKG-ELFLSCIPRNHSCSPRWIVEVASELGEVYIMRYKID-FSGNSRGYAYLQYIN- 88
                   .|:| |:::..||.:  .....:|.:..:.|:::.:|..:| .||.|||||::.|.| 
 Worm   189 EGPATGPAGQGHEIYVGHIPTD--VFEDTLVPLFEKSGKIWDLRLMMDPMSGASRGYAFVTYCNK 251

  Fly    89 VDLKESAMQY--------LPMRFRQLCMCLRVEPSTNNRELVLKNVESSLRPWQVYQEMLKIHPF 145
            .|...:|..|        .|         |:|..|..|..|.:.|:..:....::.:| ||.|..
 Worm   252 EDAAAAAKTYDGHEISTGKP---------LKVNVSIANTRLFIGNIPKTKSKDEILEE-LKTHAE 306

  Fly   146 TIVRVYEYQL-------DQFFYIFEYRNNDSAASAHQRV-RNSIRKFGEHAHISW 192
            .:|.|..|.:       ::.|...::.::.:|:...::: ::.||.|....::.|
 Worm   307 GVVDVIVYSVPDNEKIKNRGFCFVDFIDHKTASDIKRKIAQHKIRPFNADVYVDW 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutNP_729346.1 RRM1_hnRNPR_like 36..115 CDD:240695 23/89 (26%)
DUF3388 <127..169 CDD:288701 8/48 (17%)
hrpr-1NP_493049.2 RRM1_hnRNPR_like 199..277 CDD:240695 23/88 (26%)
RRM2_hnRNPR_like 280..362 CDD:240696 15/82 (18%)
RRM3_hnRNPR_like 376..445 CDD:240697
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.