DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tut and A1cf

DIOPT Version :9

Sequence 1:NP_729346.1 Gene:tut / 317996 FlyBaseID:FBgn0052364 Length:230 Species:Drosophila melanogaster
Sequence 2:XP_006231334.2 Gene:A1cf / 170912 RGDID:619834 Length:594 Species:Rattus norvegicus


Alignment Length:178 Identity:44/178 - (24%)
Similarity:80/178 - (44%) Gaps:34/178 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ELFLSCIPRNHSCSPRWIVEVASELGEVYIMRYKIDFSGNSRGYAYLQYINVDLKESAMQ----Y 98
            |:|:..:||:  .....::.:..::.::|.||..:||:||:||||::.:.|....::|::    |
  Rat    57 EIFIGKLPRD--LFEDELIPLCEKMVKIYEMRMMMDFNGNNRGYAFVTFSNKQEAKNAIKQLNNY 119

  Fly    99 LPMRFRQLCMCLRVE---------PSTNNRELVLKNVESSLRPWQVYQEMLKIHPFTI-VRVYEY 153
            .....|.|.:|..|:         |.|..||             ::..||.|:....: |.||..
  Rat   120 EIRNGRLLGVCASVDNCRLFVGGIPKTKKRE-------------EILSEMKKVTEGVVDVIVYPS 171

  Fly   154 QLDQF----FYIFEYRNNDSAASAHQR-VRNSIRKFGEHAHISWLTAE 196
            ..|:.    |...||.::.:||.|.:| :...|:.:|....:.|...|
  Rat   172 AADKTKNRGFAFVEYESHRAAAMARRRLLPGRIQLWGHPIAVDWAEPE 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutNP_729346.1 RRM1_hnRNPR_like 36..115 CDD:240695 22/89 (25%)
DUF3388 <127..169 CDD:288701 10/46 (22%)
A1cfXP_006231334.2 hnRNP-R-Q 2..594 CDD:273732 44/178 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0117
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.