DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tut and AgaP_AGAP001419

DIOPT Version :9

Sequence 1:NP_729346.1 Gene:tut / 317996 FlyBaseID:FBgn0052364 Length:230 Species:Drosophila melanogaster
Sequence 2:XP_003435823.1 Gene:AgaP_AGAP001419 / 1281757 VectorBaseID:AGAP001419 Length:532 Species:Anopheles gambiae


Alignment Length:195 Identity:38/195 - (19%)
Similarity:87/195 - (44%) Gaps:35/195 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ITITTRKVLDENLKSLLDE--------------------------GKG-ELFLSCIPRNHSCSPR 53
            :|:..:...:|.:|::|:.                          |.| |:|...||::  ....
Mosquito   120 VTVQAKGPDEEKIKAILERTGYTLDVTTGQRKYGGPPPNWTGNTPGNGCEVFCGKIPKD--MYED 182

  Fly    54 WIVEVASELGEVYIMRYKID-FSGNSRGYAYLQYINVDLKESAMQYLPMRFRQLCMCLRVEPSTN 117
            .::.:..:.|:::.:|..:| .:|.:||||::.:.:.|...:|::.|.....:...||::..|..
Mosquito   183 ELIPLFEKCGKIWDLRLMMDPMTGTNRGYAFVTFTSRDAASNAVRELNNYEIKPGNCLKINVSVP 247

  Fly   118 NRELVLKNVESSLRPWQVYQEMLKIHPFTI-VRVY----EYQLDQFFYIFEYRNNDSAASAHQRV 177
            |..|.:.|:..|....::..|..|:....: |.:|    :.:.::.|...||.::.:|:.|.:|:
Mosquito   248 NLRLFVGNIPKSKGKEEILDEFGKLTAGLVEVIIYSSPDDKKKNRGFCFLEYESHKAASLAKRRL 312

  Fly   178  177
            Mosquito   313  312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutNP_729346.1 RRM1_hnRNPR_like 36..115 CDD:240695 18/80 (23%)
DUF3388 <127..169 CDD:288701 8/46 (17%)
AgaP_AGAP001419XP_003435823.1 RRM1_hnRNPR_like 167..245 CDD:240695 18/79 (23%)
RRM2_hnRNPR_like 248..329 CDD:240696 14/65 (22%)
RRM3_hnRNPR_like 343..414 CDD:240697
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.