DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tut and AgaP_AGAP003899

DIOPT Version :9

Sequence 1:NP_729346.1 Gene:tut / 317996 FlyBaseID:FBgn0052364 Length:230 Species:Drosophila melanogaster
Sequence 2:XP_560351.3 Gene:AgaP_AGAP003899 / 1269490 VectorBaseID:AGAP003899 Length:302 Species:Anopheles gambiae


Alignment Length:111 Identity:25/111 - (22%)
Similarity:54/111 - (48%) Gaps:14/111 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LFLSCIPRNHSCSPRWIVEVASELGEVYIMRYKIDF--SGNSRGYAYLQYINVDLKESAMQYL-- 99
            |.::.:|::  .:.|.:..:.|.:|.:...|...|.  :|.|.|:.::.|:|.:..:.|::.|  
Mosquito   106 LIVNYLPQD--MTEREMYSMFSAMGPIESCRLMRDLKQTGYSYGFGFVNYLNEEAAQRAIKCLNG 168

  Fly   100 -PMRFRQLCMCLRVEPSTNNRE--LVLKNVESSLRPWQVYQEMLKI 142
             |:|.::|.:......|.:.:|  |.:.|:     |..:.:|.|.|
Mosquito   169 YPLRNKRLKVSYARPQS
DDIKETNLYITNL-----PRTITEEQLDI 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutNP_729346.1 RRM1_hnRNPR_like 36..115 CDD:240695 17/80 (21%)
DUF3388 <127..169 CDD:288701 4/16 (25%)
AgaP_AGAP003899XP_560351.3 RRM_SF 104..185 CDD:302621 17/80 (21%)
RRM_SF 191..269 CDD:302621 6/24 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.