DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tut and SYNCRIP

DIOPT Version :9

Sequence 1:NP_729346.1 Gene:tut / 317996 FlyBaseID:FBgn0052364 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_006363.4 Gene:SYNCRIP / 10492 HGNCID:16918 Length:623 Species:Homo sapiens


Alignment Length:169 Identity:39/169 - (23%)
Similarity:83/169 - (49%) Gaps:23/169 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ELFLSCIPRNHSCSPRWIVEVASELGEVYIMRYKID-FSGNSRGYAYLQYINVDLKESAMQYLPM 101
            |:|:..|||:  .....:|.:..:.|.::.:|..:| .:|.:||||::.:..   ||:|.:.:.:
Human   163 EIFVGKIPRD--LFEDELVPLFEKAGPIWDLRLMMDPLTGLNRGYAFVTFCT---KEAAQEAVKL 222

  Fly   102 -------RFRQLCMCLRVEPSTNNRELVLKNVESSLRPWQVYQEMLKI-HPFTIVRVY----EYQ 154
                   ..:.:.:|:.|   .||| |.:.::..|....|:.:|..|: ...|.|.:|    :.:
Human   223 YNNHEIRSGKHIGVCISV---ANNR-LFVGSIPKSKTKEQILEEFSKVTEGLTDVILYHQPDDKK 283

  Fly   155 LDQFFYIFEYRNNDSAASAHQRVRN-SIRKFGEHAHISW 192
            .::.|...||.::.:||.|.:|:.: .::.:|....:.|
Human   284 KNRGFCFLEYEDHKTAAQARRRLMSGKVKVWGNVGTVEW 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutNP_729346.1 RRM1_hnRNPR_like 36..115 CDD:240695 19/84 (23%)
DUF3388 <127..169 CDD:288701 10/46 (22%)
SYNCRIPNP_006363.4 NURR_hnRNPQ 23..107 CDD:410954
hnRNP-R-Q 103..615 CDD:273732 39/169 (23%)
Interaction with APOBEC1 400..561
8 X 3 AA repeats of R-G-G 448..559
3 X 4 AA repeats of Y-Y-G-Y 460..488
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 497..623
Interaction with SMN. /evidence=ECO:0000269|PubMed:11574476 518..549
Bipartite nuclear localization signal. /evidence=ECO:0000255 564..578
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0117
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.