DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tut and a1cf

DIOPT Version :9

Sequence 1:NP_729346.1 Gene:tut / 317996 FlyBaseID:FBgn0052364 Length:230 Species:Drosophila melanogaster
Sequence 2:XP_002935470.2 Gene:a1cf / 100493284 XenbaseID:XB-GENE-952965 Length:591 Species:Xenopus tropicalis


Alignment Length:169 Identity:45/169 - (26%)
Similarity:82/169 - (48%) Gaps:16/169 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ELFLSCIPRNHSCSPRWIVEVASELGEVYIMRYKIDFSGNSRGYAYLQYIN-VDLKESAMQ---Y 98
            |:|:..:||:  .....::.:..:.|:||.||..:||:||:||||::.:.| .|.:::..|   |
 Frog    57 EIFIGKLPRD--LFEDELIPLCEKTGKVYEMRMMMDFNGNNRGYAFVTFTNRQDARDAIKQLNNY 119

  Fly    99 LPMRFRQLCMCLRVEPSTNNRELVLKNVESSLRPWQVYQEMLKIHPFTI-VRVYEYQLDQF---- 158
            .....|.|.:|    .|.:|..|.:..:..:.|..::..||.|:....: |.||....|:.    
 Frog   120 EIRNGRLLGVC----ASVDNCRLFVGGIPKTKRREEILVEMRKVTDGVLDVIVYPSAADKSKNRG 180

  Fly   159 FYIFEYRNNDSAASAHQR-VRNSIRKFGEHAHISWLTAE 196
            |...||.::.:||.|.:: :...|:.:|....:.|...|
 Frog   181 FAFVEYESHRAAAMARRKLLPGRIQLWGHPIAVDWAEPE 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutNP_729346.1 RRM1_hnRNPR_like 36..115 CDD:240695 24/80 (30%)
DUF3388 <127..169 CDD:288701 11/46 (24%)
a1cfXP_002935470.2 hnRNP-R-Q 2..591 CDD:273732 45/169 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.