DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tut and rbm47

DIOPT Version :9

Sequence 1:NP_729346.1 Gene:tut / 317996 FlyBaseID:FBgn0052364 Length:230 Species:Drosophila melanogaster
Sequence 2:NP_001135499.1 Gene:rbm47 / 100216039 XenbaseID:XB-GENE-976707 Length:412 Species:Xenopus tropicalis


Alignment Length:213 Identity:47/213 - (22%)
Similarity:87/213 - (40%) Gaps:48/213 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ELFLSCIPRNHSCSPRWIVEVASELGEVYIMRYKIDFSGNSRGYAYLQYINVDLKESAMQYL--- 99
            |:|:..|||:  .....:|.|....|.::.||..:||.|.:||||::.:......:.|::.|   
 Frog    72 EVFVGKIPRD--VYEDELVPVFESAGRIFEMRLMMDFDGKNRGYAFVMFTKKHEAKQAVRELNNY 134

  Fly   100 ---PMRFRQLCMCLRVEPSTNNRELVLKNVESSLRPWQVYQEMLKIHPFTI-VRVYEYQLDQF-- 158
               |.|...:| |     |.:|..|.:..:....:..::.:|:.|:....: |.||....|:.  
 Frog   135 EIRPGRLLGVC-C-----SVDNCRLFIGGIPKMKKREEILEEISKVTEGVLDVIVYASAADKMKN 193

  Fly   159 --FYIFEYRNNDSAASAHQRVR-NSIRKFGEHAHISWL-------------------------TA 195
              |...||.::.:||.|.:::. ..|:.:|....:.|.                         |:
 Frog   194 RGFAFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETS 258

  Fly   196 ENILSRASGSF---CFQR 210
            |:.:.:..|.|   |.:|
 Frog   259 EDTIKKIFGQFNPGCVER 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tutNP_729346.1 RRM1_hnRNPR_like 36..115 CDD:240695 23/82 (28%)
DUF3388 <127..169 CDD:288701 9/46 (20%)
rbm47NP_001135499.1 hnRNP-R-Q 13..>378 CDD:273732 47/213 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.