Sequence 1: | NP_729346.1 | Gene: | tut / 317996 | FlyBaseID: | FBgn0052364 | Length: | 230 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001135499.1 | Gene: | rbm47 / 100216039 | XenbaseID: | XB-GENE-976707 | Length: | 412 | Species: | Xenopus tropicalis |
Alignment Length: | 213 | Identity: | 47/213 - (22%) |
---|---|---|---|
Similarity: | 87/213 - (40%) | Gaps: | 48/213 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 38 ELFLSCIPRNHSCSPRWIVEVASELGEVYIMRYKIDFSGNSRGYAYLQYINVDLKESAMQYL--- 99
Fly 100 ---PMRFRQLCMCLRVEPSTNNRELVLKNVESSLRPWQVYQEMLKIHPFTI-VRVYEYQLDQF-- 158
Fly 159 --FYIFEYRNNDSAASAHQRVR-NSIRKFGEHAHISWL-------------------------TA 195
Fly 196 ENILSRASGSF---CFQR 210 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
tut | NP_729346.1 | RRM1_hnRNPR_like | 36..115 | CDD:240695 | 23/82 (28%) |
DUF3388 | <127..169 | CDD:288701 | 9/46 (20%) | ||
rbm47 | NP_001135499.1 | hnRNP-R-Q | 13..>378 | CDD:273732 | 47/213 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |