DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12081 and PMD1

DIOPT Version :9

Sequence 1:NP_001259343.1 Gene:CG12081 / 31799 FlyBaseID:FBgn0030053 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_011058.3 Gene:PMD1 / 856869 SGDID:S000000934 Length:1753 Species:Saccharomyces cerevisiae


Alignment Length:274 Identity:66/274 - (24%)
Similarity:102/274 - (37%) Gaps:89/274 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 PLKYPLVPFQRYGHTVVAYKDRIYIWGGRNDENLCNTLYCFDPKTAQWSRPQVT-GCLPG----- 126
            ||..|:||                                 :|...:.:|.::| .|..|     
Yeast    13 PLNLPIVP---------------------------------NPNLDEATRKKLTLECRTGAAVEL 44

  Fly   127 ARDG---HSA------CVIGNSMYI-------FGGFVDEINEF-------SSDVHSLNLDTMEWR 168
            ||.|   |..      ..|.||:.:       ||...|...:|       |.::..|:|.:..|:
Yeast    45 ARSGVFVHGGLTLPLNLTIINSLQLQKELILYFGKQKDRNADFKTLADWISPEIFFLDLISRTWQ 109

  Fly   169 YVQTF-----------GVPPSYRDFHASVAYEQERMYIFGGRGDKHSPYHSQEETYCHEIVYLDM 222
            .:.|.           |:....|.|| |:.:.:..:|||||.  ..||::..|....:|:..||:
Yeast   110 RINTTIDTTSENELNNGLSFKERLFH-SMCFTESNIYIFGGL--MVSPHNGYELIATNELWKLDL 171

  Fly   223 KTKVWHRPFTAGKVPVGRR-SHSMFVYN--------KLIYVFGGYNGLLDQHFNDLYTFDPRTKL 278
            |||.|  ...:....:.|| :|||.|.|        |||.| ||.:. :|.....:..|:.||.|
Yeast   172 KTKCW--SLISENPQITRRFNHSMHVLNENNENQDTKLIIV-GGLDN-MDIPVKKIDIFNLRTSL 232

  Fly   279 WNLIRANGKAPTAR 292
            |.....:.:.|.::
Yeast   233 WESESKSDENPASK 246

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity