DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12081 and KEL3

DIOPT Version :9

Sequence 1:NP_001259343.1 Gene:CG12081 / 31799 FlyBaseID:FBgn0030053 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_015060.1 Gene:KEL3 / 855865 SGDID:S000006184 Length:651 Species:Saccharomyces cerevisiae


Alignment Length:173 Identity:45/173 - (26%)
Similarity:78/173 - (45%) Gaps:19/173 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 PFQRYGHTVVAYKDRIYIWGGRND-----ENLCNTLYCFDPKTAQWSRPQVTGCLPGARDGHSAC 134
            |..|.||.::|:|:...::||..|     .:..|.|:|||..|.:|::.: |...|.||.||...
Yeast   194 PSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWTKLE-TNSKPDARSGHCFI 257

  Fly   135 VIGNSMYIFGGFVDEI---------NEFSSDVHSLNL--DTMEWRY--VQTFGVPPSYRDFHASV 186
            ...||..:.||:...|         .:..:|...|||  |..:|::  ::.|...||.|..::..
Yeast   258 PTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFKNQPSPRVGYSFN 322

  Fly   187 AYEQERMYIFGGRGDKHSPYHSQEETYCHEIVYLDMKTKVWHR 229
            .::|.:...|||..|......|.|..:.:::....::...|.:
Yeast   323 LWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFHLELNKWSK 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12081NP_001259343.1 KELCH repeat 13..69 CDD:276965
Kelch_6 13..60 CDD:290672
KELCH repeat 78..125 CDD:276965 16/51 (31%)
Kelch_1 78..117 CDD:279660 15/43 (35%)
KELCH repeat 128..170 CDD:276965 14/54 (26%)
Kelch_3 137..188 CDD:290151 15/63 (24%)
KELCH repeat 180..236 CDD:276965 9/50 (18%)
Kelch_3 192..248 CDD:290151 7/38 (18%)
Kelch_5 237..276 CDD:290565
KEL3NP_015060.1 Kelch_3 92..146 CDD:404319
PLN02153 94..>316 CDD:177814 36/122 (30%)
KELCH repeat 138..194 CDD:276965 45/173 (26%)
KELCH repeat 197..242 CDD:276965 15/44 (34%)
Kelch_3 206..255 CDD:404319 16/49 (33%)
KELCH repeat 251..308 CDD:276965 14/56 (25%)
Kelch_4 315..371 CDD:404322 9/51 (18%)
Kelch_2 453..506 CDD:400133
DUF4110 564..651 CDD:404326
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1494
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.