DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12081 and AT3G07720

DIOPT Version :9

Sequence 1:NP_001259343.1 Gene:CG12081 / 31799 FlyBaseID:FBgn0030053 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_566316.1 Gene:AT3G07720 / 819963 AraportID:AT3G07720 Length:329 Species:Arabidopsis thaliana


Alignment Length:238 Identity:61/238 - (25%)
Similarity:110/238 - (46%) Gaps:18/238 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 PFQRYGHTVVAYKDRIYIWGGRNDEN--LCNTLYCFDPKTAQWSRPQVTGCLPGARDGHSACVIG 137
            |..|..|.:....:::|.:||.....  :.|.||.||.:|..||..:.:|..|..|.|.:...:|
plant    20 PGARSSHAIALVGNKMYAFGGEFQPRVPVDNQLYVFDLETQTWSIQEASGDAPPPRVGVAMAAVG 84

  Fly   138 NSMYIFGGFVDEINEFSSDVHSLNLDTMEWRYVQTFGVPPSYRDFHASVAYEQERMYIFGGRG-D 201
            ..:|.||| .|..::..::::..|..|.:|:.:.:....|..|.:| |:..:.:.:|:|||.| |
plant    85 PIIYFFGG-RDSTHQELNELYCFNTLTNQWKLLSSGETGPQNRSYH-SITADSQNVYVFGGCGVD 147

  Fly   202 KHSPYHSQEETYCHEIVYLDMKTKVWHRPFTAGKVPVGRRSHSMFVYNKLIYVFGGYNGLLDQHF 266
            ..     ..:.:.:.:|  |.|   |.:..:.|:...||....:.|....|:|..|:.|   :..
plant   148 GR-----LNDLWAYNVV--DQK---WIKFPSPGEACRGRGGPGLEVVQGKIWVVYGFAG---EEA 199

  Fly   267 NDLYTFDPRTKLWNLIRANGKAPTARRRQCAIVMGTRMFLFGG 309
            :|::.||.....|..:...|:.|:||......|:|.::.:.||
plant   200 DDVHCFDIAKGEWKEVETKGEKPSARSVFSTAVVGKQILISGG 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12081NP_001259343.1 KELCH repeat 13..69 CDD:276965
Kelch_6 13..60 CDD:290672
KELCH repeat 78..125 CDD:276965 14/48 (29%)
Kelch_1 78..117 CDD:279660 12/40 (30%)
KELCH repeat 128..170 CDD:276965 11/41 (27%)
Kelch_3 137..188 CDD:290151 13/50 (26%)
KELCH repeat 180..236 CDD:276965 14/56 (25%)
Kelch_3 192..248 CDD:290151 13/56 (23%)
Kelch_5 237..276 CDD:290565 10/38 (26%)
AT3G07720NP_566316.1 PLN02193 <1..322 CDD:177844 61/238 (26%)
KELCH repeat 23..71 CDD:276965 14/47 (30%)
KELCH repeat 75..123 CDD:276965 11/48 (23%)
KELCH repeat 126..168 CDD:276965 13/52 (25%)
KELCH repeat 176..215 CDD:276965 10/41 (24%)
KELCH repeat 225..272 CDD:276965 5/18 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I2331
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D933937at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.930

Return to query results.
Submit another query.